SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386017259|ref|YP_005935557.1| from Pantoea ananatis AJ13355

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386017259|ref|YP_005935557.1|
Domain Number 1 Region: 6-364
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.47e-106
Family FMN-linked oxidoreductases 0.00000000149
Further Details:      
 
Domain Number 2 Region: 380-607
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.98e-40
Family C-terminal domain of adrenodoxin reductase-like 0.0000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386017259|ref|YP_005935557.1|
Sequence length 673
Comment 2,4-dienoyl-CoA reductase [NADPH] FadH [Pantoea ananatis AJ13355]
Sequence
MTALPSHYPALFTPLDLGFTQLRNRFLMGSMHTGLEEREDGAARLAAFYGERAREGVALI
VTGGVSPNPQGVTAEHGAVLNDDAQCDWHRQITAAVHQHEGKIALQILHTGRYSFQRGLV
APSAIQAPINRFTPRELSDAEVEQTIADFAHCARLAQKAGYDGVEIMGSEGYLINQFLVQ
HTNQRQDRWGGDFTGRMQFALAITRAVRQVTGERFIIIFRLSMLDLIHHGSTLDETLQLA
SELERCGVTLFNTGIGWHEARIPTIATCVPRAAFAWVTRRLRQHVAVPVVATNRINHPQV
AEQLLQDGCADMVSMARPFLADAAFVSKAQRGDDNSINTCIACNQACLDQIFAGHVTSCL
VNPRACHESLMPVTPTRAAKRLAVVGAGPAGMAFALQAAERGHQVTLYDAAPDIGGQFNI
ARQIPGKEEFSETLRYFRHRLPAAGVVIKTGCRVSAAMLADVDEVILATGIKPRTPEIPG
IDHPSVLSYLDVLADKRPVGPRVAIIGAGGIGFDTAEYLSQPHQTETVDDFYREWGIDHS
LTQRGGLIAPAPLRSPRQIWLLQRKAGKPGATLAKTTGWIHRSSLQSRGVEMWGGITYLA
IDDEGLHIKRDGEPLVLPVDNVIICAGQEPQRELEAALRANGKPVQVIGGADVAQELDAR
RAIAQATALALTL
Download sequence
Identical sequences A0A0H3KZZ9
WP_014594680.1.100875 WP_014594680.1.61179 gi|386017259|ref|YP_005935557.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]