SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386014859|ref|YP_005933136.1| from Pantoea ananatis AJ13355

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386014859|ref|YP_005933136.1|
Domain Number 1 Region: 5-99
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 6.02e-33
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386014859|ref|YP_005933136.1|
Sequence length 104
Comment N,N'-diacetylchitobiose-specific phosphotransferase enzyme IIA component ChbA [Pantoea ananatis AJ13355]
Sequence
MEIDESTVIELIIQAGEARSCSMEALRAARQQNWERADSMLTAATAAAKAAHQIQTRLIG
ADEGSGKIPVNLIMVHAQDHLMNAMLCRELAEEIIQLRRELAAR
Download sequence
Identical sequences A0A0H3L0S7 A0A221N8H2 D4GL52
gi|386080461|ref|YP_005993986.1| WP_013024822.1.100875 WP_013024822.1.101504 WP_013024822.1.22816 WP_013024822.1.25584 WP_013024822.1.31804 WP_013024822.1.32245 WP_013024822.1.34141 WP_013024822.1.37529 WP_013024822.1.41207 WP_013024822.1.44942 WP_013024822.1.45452 WP_013024822.1.46475 WP_013024822.1.47668 WP_013024822.1.55774 WP_013024822.1.57057 WP_013024822.1.61179 WP_013024822.1.64732 WP_013024822.1.7182 WP_013024822.1.89124 WP_013024822.1.95616 gi|291616484|ref|YP_003519226.1| gi|386014859|ref|YP_005933136.1| gi|378768333|ref|YP_005196805.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]