SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386017798|ref|YP_005936098.1| from Pantoea ananatis AJ13355

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386017798|ref|YP_005936098.1|
Domain Number 1 Region: 16-115
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.75e-35
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386017798|ref|YP_005936098.1|
Sequence length 115
Comment N,N'-diacetylchitobiose-specific phosphotransferase enzyme IIA component ChbA [Pantoea ananatis AJ13355]
Sequence
MLRLPKITVLIESTIMIELEDAVMTIIVNAGHARSLCFEALQAARKGDVDEAKARLKEAD
DYSRTAHQMQTRLIEQDAGEARQPMTLIMVHAQDHLMTSMLARELAEEIVYLYQR
Download sequence
Identical sequences A0A0H3L1L3
gi|386017798|ref|YP_005936098.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]