SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|315230289|ref|YP_004070725.1| from Thermococcus barophilus MP

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|315230289|ref|YP_004070725.1|
Domain Number - Region: 17-104
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.0994
Family MJ1460-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|315230289|ref|YP_004070725.1|
Sequence length 195
Comment hypothetical protein TERMP_00525 [Thermococcus barophilus MP]
Sequence
MIAFLLYLVSLIFIILNWHLGKNIYEWAFYDILFYVFLPLTAAYLLGFKPNELGFKIGKR
EGYIWAFVLFSATLPVSVYASRIESFRSFYPIFSYSSWGDFIFKELLIGAIMFAHEAFYR
GILLFPLAEKNEWLGILLQNIPYTLIHIGKPTLEIPYSFIAGIIFAKMDLKSESFLPSFL
LHWIGAVAFDVLCII
Download sequence
Identical sequences F0LJW5
gi|315230289|ref|YP_004070725.1| WP_013466800.1.91259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]