SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|315230430|ref|YP_004070866.1| from Thermococcus barophilus MP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315230430|ref|YP_004070866.1|
Domain Number 1 Region: 247-602
Classification Level Classification E-value
Superfamily SIS domain 1.02e-110
Family double-SIS domain 0.000000167
Further Details:      
 
Domain Number 2 Region: 2-231
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.92e-73
Family Class II glutamine amidotransferases 0.00000372
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|315230430|ref|YP_004070866.1|
Sequence length 602
Comment glucosamine--fructose-6-phosphate aminotransferase [Thermococcus barophilus MP]
Sequence
MCGIIGYIGERKACNVLVDGLKRLEYRGYDSVGIVTEEDGKLYIRKGAGKIDELKEKLGL
LEMPGKRGIGHTRWATHGIPNDINAHPHTDCTGKIAVVHNGIIENYIELKDELLRKGHKF
KSDTDTEIIAHLIEDALKDFNNFEDALRYALLRLKGSFALGIIYTHDREHLYFVRNESPL
VLGIGHGEMFAASDIPAFLPYTNKAVFLDDGEYAVVTKDSFVVKDLKTGQVKEKKVHEIN
WTLEMAEKQGYEHFMLKEIHEQPKAVKEAIYGNLGMIDKIAREIANYEKIYIVAMGTSYH
AALVGKYIFQRLVKKVPVVEDASEFRYEFEDLIDRDTLVIAITQSGETADTLAAIKLAKK
KGAKVLSIVNVVGSMATRLSDLVLYTHAGPEIGVAATKTYTTQLTVISMLAIALAKYLNT
ADREYLQKIEAELYDMPKYIEAALGYENKIKNLAERLKEKRDFFYIGRGISLATALEGAL
KLKEISYIHAEGLSAGELKHGPLALIEEDVPVVAIAPSGKTLEKMISNIQEAKARGALII
SLGDSEELRKVSDILIKMPKVDEVLSPIVYIVPLQLLAYHLSVLRGNDPDKPRNLAKSVT
VE
Download sequence
Identical sequences F0LKR4
WP_013466941.1.91259 gi|315230430|ref|YP_004070866.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]