SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|315230522|ref|YP_004070958.1| from Thermococcus barophilus MP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315230522|ref|YP_004070958.1|
Domain Number 1 Region: 29-241
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.39e-44
Family Decarboxylase 0.0044
Further Details:      
 
Domain Number 2 Region: 243-433
Classification Level Classification E-value
Superfamily SIS domain 3.84e-40
Family mono-SIS domain 0.000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|315230522|ref|YP_004070958.1|
Sequence length 435
Comment D-arabino-3-hexulose 6-phosphate formaldehyde lyase / 6-phospho-3-hexuloisomerase [Thermococcus barophilus MP]
Sequence
MSKILRVKVKKCAIDVKVEALRKYSEEFKMILQVALDLTDIEQAISIAEKAARGGAHWLE
VGTPLIKKEGMRAVELMKRRFPDRKIVADLKTMDTGALEVEMAARHGADVVSILGVADNK
TIRDALMVARKYGIKVMVDLIGVKDKVKRAKELEKMGVHYILVHTGIDEQAQGKSPLEDL
EKVVKAVKIPVAVAGGLNLETIPKVIELGATIIIVGGAITKSENPEEVTRRIIDLFWDEY
MQTIRKAMHDITEHIDHVADALRLEEVRGMVDAMIGANKIFIYGAGRSGLVGKAFAMRLM
HLDFNVYVVGETITPAFEEGDLLIAISGSGETRTIVDAAEIAKKQGGKVVAITSYKNSTL
GKLADVVVEIPGRAKTDVPTDYIARQMLTQYKWIAPMGTLFEDSTMVFLDGIIALLMATF
QKTEKDMKRKHATLE
Download sequence
Identical sequences A0A0S1XAT5 F0LL84
gi|315230522|ref|YP_004070958.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]