SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|315231500|ref|YP_004071936.1| from Thermococcus barophilus MP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315231500|ref|YP_004071936.1|
Domain Number 1 Region: 8-60,209-420
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.81e-35
Family Bacterial dinuclear zinc exopeptidases 0.049
Further Details:      
 
Domain Number 2 Region: 89-199
Classification Level Classification E-value
Superfamily PA domain 0.000000106
Family PA domain 0.0046
Further Details:      
 
Weak hits

Sequence:  gi|315231500|ref|YP_004071936.1|
Domain Number - Region: 494-555
Classification Level Classification E-value
Superfamily HRDC-like 0.0432
Family RNA polymerase II subunit RBP4 (RpoF) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|315231500|ref|YP_004071936.1|
Sequence length 560
Comment hypothetical protein TERMP_01738 [Thermococcus barophilus MP]
Sequence
MKEFLEESRINVDEILRHIMNISQFHRIQGSKEIVDAAKYILEELKKAGIDAQLLKDVYD
GETWHLTLKSPIGWDLIYGEIEIFGKKFTTEEIPLVVMAHSPSGEAEGEMVYIEREDDWE
KAEGKIVLVGKKWKDNYKKANKSGAIGFVAYRKGTGKAFPYMGLFLSRKDLEWAKIPAVA
VSEEIANKIISKLKKGESVKAKIRVQTEIRDKQILPMVYAKIGKPPYILFTAHICHPKPG
ANDNASGSAMLIELAKALKEKHSEDFRFGFAFLWIPEYHGTQAFIEKFAELENYYAVINL
DMVGGSEDRSNSTIMIVRTPLSRFSIVSGLLEYYLNLANSQGESFGGEGMPKLKVKSYSY
QMGSDHDIFNFFGVPGVMPITWPDKFYHSSEDSIEKISKDSLEVIGKAVLATALALAKAE
KEKLQRFARGYAMKYLGELGMDREIEVAEKLVMRGLARDGKFLGIDIGHDLEFKAWIKWK
RKGLVSVRTIREFEEKAAKELEEFMEDKKFSIHLHELLMLGEILPEEEAFKALEEEFGKI
DREKLNKALEILKKLGFIEC
Download sequence
Identical sequences F0LJS1
WP_013468010.1.91259 gi|315231500|ref|YP_004071936.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]