SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386077816|ref|YP_005991341.1| from Pantoea ananatis PA13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386077816|ref|YP_005991341.1|
Domain Number 1 Region: 6-366
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.57e-107
Family FMN-linked oxidoreductases 0.00000000151
Further Details:      
 
Domain Number 2 Region: 382-609
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.98e-40
Family C-terminal domain of adrenodoxin reductase-like 0.0000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386077816|ref|YP_005991341.1|
Sequence length 675
Comment 2,4-dienoyl-CoA reductase FadH [Pantoea ananatis PA13]
Sequence
MIMTALSSHYPALFTPLDLGFTQLRNRFLMGSMHTGLEEREDGAARLAAFYGERAREGVA
LIVTGGVSPNPQGVTAEHGAVLNDDAQCDWHRQITAAVHQHEGKIALQILHTGRYSFQRD
LVAPSAIQAPINRFTPRELSDAEVEQTIADFAHCARLAQKAGYDGVEIMGSEGYLINQFL
VQHTNQRQDRWGGDFTGRMQFALAITRAVRAATGDRFIIIFRLSMLDLIHHGSTLEETLQ
LASELERCGVTLFNTGIGWHEARIPTIATCVPRAAFVWVTRRLRQHVAVPVVATNRINHP
QVAEQLLQDGCADMVSMARPFLADAAFVSKAQRGDDNSINTCIACNQACLDQIFAGHVTS
CLVNPRACHESLMPVTPTRAAKRLAVVGAGPAGMAFALQAAERGHQVTLYDAAPDIGGQF
NIARQIPGKEEFSETLRYFRHRLPAAGVVIKTGCRVSAAMLADVDEVILATGIKPRTPEI
PGIDHPSVLSYLDVLADKRPVGPRVAIIGAGGIGFDTAEYLSQPHQTETVDDFYREWGID
HSLTQRGGLIAPAPLRSPRQIWLLQRKAGKPGATLAKTTGWIHRSSLQSRGVEMWGGITY
LAIDDEGLHIKRDGEPLVLPVDNVIICAGQEPQRELEAALRANGKPVQVIGGADVAQELD
ARRAIAQATALALTL
Download sequence
Identical sequences gi|386077816|ref|YP_005991341.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]