SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386080750|ref|YP_005994275.1| from Pantoea ananatis PA13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386080750|ref|YP_005994275.1|
Domain Number 1 Region: 35-503
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.38e-119
Family Pyridoxal-dependent decarboxylase 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386080750|ref|YP_005994275.1|
Sequence length 517
Comment L-2,4-diaminobutyrate decarboxylase Ddc [Pantoea ananatis PA13]
Sequence
MVLRKQNLSVPRRHLPDEVLTAQDFIFNDAQIPAWHQQTQEALALISSTIQRVEKPFSGI
LPHELAPAFSAVDLDQPLGNNEAALEELRTLYLRDAVWFHHPKYVAHLNCPVVLPSLLAE
QIMAAVNSSVDTWDQSAGGTLIEQKVIDWTLGRIGLPASADGIFTSGGTQSNLMAMLLAR
DSWCAAHHPGHLIKHQGLPADAAKWRVLTSRLSHFSIQKSMAILGLGYDAVIPVAYDDHY
RMDSVQLEQEIQRCHEQGLIPIAVVATSGTTDFGSIDPLESIAKLCQQHGIWMHVDAAYG
CGLLVSEQHRQRLNGIEKADSVTVDYHKSFFQTVSCGAFFVREKQHLSHVTHHADYLNPL
SAQQEGTPNLVNKSIQTTRRFDALKMWLTLRIMGPSALGEAFDTILTLTQATHQRLNAHP
AIEVLHAPELTTQIFRFVPRPGMNPAQLDAINAGIRKALFRSGNAVIAGTKVEGRQYLKF
TLLNPTTSVADIEDVIALIAHYGREQARDVTLPVANQ
Download sequence
Identical sequences gi|386080750|ref|YP_005994275.1| WP_014606632.1.44942 WP_014606632.1.57057 WP_014606632.1.7182 WP_014606632.1.95616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]