SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|58617120|ref|YP_196319.1| from Ehrlichia ruminantium str. Gardel

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|58617120|ref|YP_196319.1|
Domain Number 1 Region: 538-1027
Classification Level Classification E-value
Superfamily ALDH-like 8.51e-129
Family ALDH-like 0.000000212
Further Details:      
 
Domain Number 2 Region: 189-521
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.92e-104
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000207
Further Details:      
 
Domain Number 3 Region: 9-177
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 5.89e-60
Family N-terminal domain of bifunctional PutA protein 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|58617120|ref|YP_196319.1|
Sequence length 1043
Comment bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Ehrlichia ruminantium str. Gardel]
Sequence
MISALQVPNEIRRRMQLLYRTEENSYARYLTEKTEISQDSKIRIYSVAKQIIEKIRGGRN
LGIIDAFMQEYGLSNEEGIALMCLAESLLRVPDDCTINDLIKDKIANSMWSNHIGNSSSM
FVNAATWGLFIGGRVLKDTNDSTRWFSTINNLIKTMGEPIIRKAVQQAMYVLGKHFIKGR
DIIEAIGNRKESELYSFDILGEASKTKKDAERYFTEYMKAIDSIGKSINNVTENLVDHDE
ISVKISALHNRYEFSQINEVLDEIVDKLLSICRLAKQNNIRVCIDAEEASRLEISLMILE
KLRLDSSLDGWEGLGLAVQAYQKRAFSVLDFVEDIAVRSSHKMMIRLVKGAYWDYEIKNA
QELGLSSYPVFTRKVYTDVSYLACAYKILTKQNTFYPCFATHNAYTLATILEIADKDHPG
FEFQRLHGMGTSLYEYVTQEMAANIKCRVYAPVGSYQDLLPYLIRRLLENGANSSFINQM
NDSNITLDQLIEDPLEKAKSFEYMPHPSISLPKDIFGDERINSAGIDITDSVTLVNFNEE
MKEYKEHKFKALSIINGEELGSQAIEVFSPSNSEDVVGEVSFADATQAVSALDIAYDAFK
EWSSMSVYDRAAILEKAADLIEENKAKLIVLLIREGGKVISDAIAEVREAVDFLRYYVAM
GKKELGDSKKLPGPVGEDNYIYFRSRGVFICISPWNFPLAIFIGPIVAALITGNTVLAKP
AEQTSIIAYEAVKLLYDAGVPKGVLHLLLGHGKELGEVLLKNEKIAGVAFTGSTETARII
NQAIAEKEGAIIPFIAETGGLNTMIVDSSALIEQVTNDVIASAFKSAGQRCSALRVLFVQ
EEIADKQIEMICGAMEDLVIGDPMLLKTDIGPVIDDASREMLFTHADRMSREGKLLCKVN
LGEDCDKGYFFPPCAYEIESISQLKREVFGPILHIIRYKKGDLHKILTEINNTGYGLTFA
VQSRIQSNIDNIIDNINVGNVYVNRNQVGAVVGVQPFGGQGLSGTGPKAGGPYYLHRFLT
EKVISINTTALGGNTTLMCLNDE
Download sequence
Identical sequences Q5FH19
302409.ERGA_CDS_03930 gi|58617120|ref|YP_196319.1| WP_011255533.1.7790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]