SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378765978|ref|YP_005194439.1| from Pantoea ananatis LMG 5342

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378765978|ref|YP_005194439.1|
Domain Number 1 Region: 192-329
Classification Level Classification E-value
Superfamily CBS-domain pair 6.95e-23
Family CBS-domain pair 0.0036
Further Details:      
 
Domain Number 2 Region: 340-421
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.54e-21
Family CorC/HlyC domain-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378765978|ref|YP_005194439.1|
Sequence length 428
Comment transporter, HlyC/CorC family [Pantoea ananatis LMG 5342]
Sequence
MEHVSTTTLIVTLIIMVLVSAYFSGSETGMMTLNRYKLRHQAKHGHRAARRVEKLLKRPD
RLISLVLIGNNLVNILASAIGTIVGMRLYGDAGVAIATGILTFVVLVFAEVLPKTVAALY
PEKVAYPSSFLLGPLQYIMLPLVWLLNTITRLLMRLVGIRADGAISSALSKEELRTIVYE
SRTHMSRRNQDMLLSVLDLEKVSVDDIMVPRNEIVGININDDWKSVIRQLSHSPHGRIVL
FRDSLDDCVGMLRVREAWRMMTEKKEFTKEMLLRAADEIYYIPEGTPLNVQLVKFQRNKK
KTGLVVDEYGDIKGLISIEDILEEIVGDFTTSMSPSLAEEVMPQNDGSVLIEGSANIREI
NKAFNWQLPEQEARTINGMLLEALEEIPTVNTRVQVNHYDVDILDVQDNMIKQVRITPQT
PLKQSVGS
Download sequence
Identical sequences A0A221N2B9 D4GLE0
gi|378765978|ref|YP_005194439.1| gi|386078235|ref|YP_005991760.1| gi|291618579|ref|YP_003521321.1| WP_013026898.1.100875 WP_013026898.1.101504 WP_013026898.1.22816 WP_013026898.1.25584 WP_013026898.1.31804 WP_013026898.1.32245 WP_013026898.1.34141 WP_013026898.1.37529 WP_013026898.1.41207 WP_013026898.1.46475 WP_013026898.1.47668 WP_013026898.1.55774 WP_013026898.1.57057 WP_013026898.1.61179 WP_013026898.1.7182 WP_013026898.1.89124 WP_013026898.1.95616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]