SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378766992|ref|YP_005195457.1| from Pantoea ananatis LMG 5342

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378766992|ref|YP_005195457.1|
Domain Number 1 Region: 291-429
Classification Level Classification E-value
Superfamily CBS-domain pair 5.05e-23
Family CBS-domain pair 0.0053
Further Details:      
 
Domain Number 2 Region: 434-520
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 4.36e-17
Family CorC/HlyC domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378766992|ref|YP_005195457.1|
Sequence length 522
Comment integral membrane protein [Pantoea ananatis LMG 5342]
Sequence
MEFLFDPSIWAGLLTLIVLEIVLGIDNLVFIAILADKLPPKQRDKARLIGLSLALVMRLG
LLSLISWMVTLTRPLFSVGDFSFAGRDLILLAGGIFLLFKATMELHERLENRQLENSGNR
SYASFWAVVTQIVILDAVFSLDAVITAVGMVNNLPVMMTAVVIAMVVMLLASKPLTKFVN
AHPTVVVLCLSFLLMIGLSLVAEGFGFHIPKGYLYAAIGFSILIELFNQIARRNFIRHQS
HRPMRERTAEAILRLMGGRNRVQSAPASTEEQAIAVAMPQEAFKDEERYMINGVLTLASR
SIRSIMTPRGDISWVDANRPVDEIRIQLLDTPHSLFPVCRGELDEIIGVVRAKELLVALD
HGVDVATFAASTPTIIVPETLDPINLLGVLRRAKGSFVIVTNEFGVVQGLITPLDVLEAI
AGEFPDEDETPDIIMDGDGWLVKGGTDLHSLQQLLDFHELVKPEEDHASLAGLLIAQKGQ
LPKPGDVIDIEPLHFQIIDATEYRIDLVRVTKDQRDDDEEEG
Download sequence
Identical sequences A0A0H3KWV3 A0A221N5Y4
gi|386079162|ref|YP_005992687.1| gi|386016054|ref|YP_005934339.1| gi|378766992|ref|YP_005195457.1| WP_014593852.1.100875 WP_014593852.1.101504 WP_014593852.1.22816 WP_014593852.1.31804 WP_014593852.1.32245 WP_014593852.1.34141 WP_014593852.1.37529 WP_014593852.1.44942 WP_014593852.1.45452 WP_014593852.1.46475 WP_014593852.1.47668 WP_014593852.1.57057 WP_014593852.1.61179 WP_014593852.1.64732 WP_014593852.1.7182 WP_014593852.1.89124 WP_014593852.1.95616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]