SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Naegr1|76369|fgeneshNG_pg.scaffold_126000001 from Naegleria gruberi

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Naegr1|76369|fgeneshNG_pg.scaffold_126000001
Domain Number - Region: 279-355
Classification Level Classification E-value
Superfamily Colicin 0.0262
Family Colicin 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Naegr1|76369|fgeneshNG_pg.scaffold_126000001
Sequence length 412
Sequence
MILSGCLLVWLSSYLVTEKAINDLSTKLINESGRKIITYLDGVMTPIAKLTKTMAREYTT
GVVTIPMFRNYLFPKFVEFRTTGCGFFFSVPLPSRYTYTISGTTSNPFPVFAYQPYGYPG
TIRDIVNITTGDIVKVNSTVDLTPYVPAKQDFFIYTLKNYYEKGLEGVYGEPYKVLGSTV
AIYYSQLMYDPEIYKLNKTKSLVGLAKVNLSLETIVNFLSKIELLGRGYVLVAQDNFIVI
GGSIDTISGDGLNSTNIFDVKSRNAGSLMKQFYELNNRTFSILPSVMKIVGESDGVSYII
TPYKYVLENMQWNIFFVLYESEVTEALILTTSISIGVTVGIIVLGIVGSFVTGLVVSRPM
KFLEKQFERIKVLDLGSVSNNSSMFREVNSIFNNLKNTVEWLAEIKTFIPQS
Download sequence
Identical sequences D2W4N4
XP_002668711.1.8020 jgi|Naegr1|76369|fgeneshNG_pg.scaffold_126000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]