SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Naegr1|59484|estExt_fgeneshHS_pg.C_620058 from Naegleria gruberi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Naegr1|59484|estExt_fgeneshHS_pg.C_620058
Domain Number 1 Region: 154-503
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 8.37e-79
Family IF2B-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Naegr1|59484|estExt_fgeneshHS_pg.C_620058
Sequence length 507
Sequence
MQQTQNAPEEGDNSEGRTMTADEKKKQREAKKMEKKQAKEQKGGLSKEERKKLFETNENN
KRQERLKAKEEAENITTPTMPSNVTNNSTNPTTSQQTNASDQRLREENERLKKELLQRDK
LYLDLKKKYQENRISSHLPEYQPPKQTEINTGKLHPQVIQLGIQYASGQITGCNARTLAM
FTVLKQLVNDTEIPEDKQFSRCLDPLVSSVIDHLKQCRPMSVGMKNALRRFKYCLHQIDK
ESYIRTHQQRKEALSEYVDRYIEERISVPEKEIVKKGVNGIKDGDTILTYALSEVLEKMI
IEAAQSKKISVIVVDSRPKNEGKELVKRLTRAGVKCSIVLVNAVTYVMKDVSKVFLGANS
ILSNGNVYSRVGTAVVAMTAKAFNIPVVVCCETYKFSAHSQLDSITTNELGDPYDLVDLS
TTPQRHHTVNYLSSNEIGQLEVEGVTKFDDKETVYNMENFESIPNLHIVNLTYDLTPCHY
VDMVLCEFGAIPPTSVSVILREYVDYQ
Download sequence
Identical sequences D2VX98
jgi|Naegr1|59484|estExt_fgeneshHS_pg.C_620058 XP_002671332.1.8020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]