SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Naegr1|71907|fgeneshNG_pg.scaffold_49000150 from Naegleria gruberi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Naegr1|71907|fgeneshNG_pg.scaffold_49000150
Domain Number 1 Region: 5-164
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-42
Family DBL homology domain (DH-domain) 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Naegr1|71907|fgeneshNG_pg.scaffold_49000150
Sequence length 286
Sequence
MRFNLTISQIQKIFNNLSTILSMHRIFLINLEQKLKEWPNVFIGESFMNQSFFFLFYVEY
INGYNESSNTLRELRLKNREFLTFLNETKKHKECKGLSLESFLILPIQRLPRYKLLLKGV
LKHTLPDHTDYQNLKSAYNRISAINNAINSKKKEHETYLIINKMFNEMKIFSRESPIANT
HIDWSKKLYKQLHLTKEDEQINNVKQFEMREILRICDQVFHKFSTTSSLNKLESTVFEEP
SPRNSMMKTLSFLKKSPSLTAVKHTEDEEHEVKKLIDTIQVNTEHF
Download sequence
Identical sequences D2VSE0
XP_002673075.1.8020 jgi|Naegr1|71907|fgeneshNG_pg.scaffold_49000150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]