SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Naegr1|76536|fgeneshNG_pg.scaffold_186000002 from Naegleria gruberi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Naegr1|76536|fgeneshNG_pg.scaffold_186000002
Domain Number 1 Region: 78-178
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-19
Family DBL homology domain (DH-domain) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Naegr1|76536|fgeneshNG_pg.scaffold_186000002
Sequence length 209
Sequence
KDDKNSKIITAPPPSNNTNNNNTNNNTPPPTLNTTSSPPPKKDTSTTTNNTNNTSTTTNT
STTTNTSNNYQSHYSRTVHTNLPQAYQEYPKFKQVIQDSSKNVKGTDGLDLTSLLIMPCQ
RIVKYCLLSKAILKETNENHSDYEMLNLTCQKIQQQAHEINRKMKDIANLKNLIDIAYRY
NIDKLNLKFIYLMIQFYLQKNILILHLIY
Download sequence
Identical sequences D2W548
jgi|Naegr1|76536|fgeneshNG_pg.scaffold_186000002 XP_002668549.1.8020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]