SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Naegr1|79341|estExt_fgeneshNG_pg.C_170218 from Naegleria gruberi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Naegr1|79341|estExt_fgeneshNG_pg.C_170218
Domain Number 1 Region: 147-252
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.000000785
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Naegr1|79341|estExt_fgeneshNG_pg.C_170218
Sequence length 1596
Sequence
MSTITWKSKYKMNYILMLALILMIVIFNAESKVINGSRSRSRNNSAATITTTSNNKKVTE
SISKKDENYIPIKCPPNKSLLYQFKTTTLIGNSGISKKGSHRGQSGRSETIISGSIILTC
PSKSIRNKALSIDPSTTTTTQLNDQQDNKKKNIILVTFNQVTFNQFRGRTSTNKKYRKLD
ARKDLTSELNKKPFIFTQSQSGHVQNLIFKQSEERYIRSIKKGIIRMLTTETRKRARSQT
DGFGGRYHKSYNRNYQIGKLTKNRRTLNIHQKYNQDDFITALPVNKRHLHYEGTHIVNVS
IRKNLIRNSLMKIHFTFGPSKIGNEKHYAFKEFEKLTKSSQKDKLPEQDATSELETLFIG
KIELKQVKNVKLNLEKEIQETIINLEKNGRSAKLGNEFTFENSFSINKFDKKSMMSLKRR
EFSSKYFNRLLNGCKQDPSLSRNSNILLAALAKYSKLHPIKSGDILLNELEKGIKQLNKM
MINDNNDNNKKSKDNNKKSNDNSNNSKKSKEERLSLKNYLESIQNLVATIKSQRIQNSLV
KLSSMHPYLTHNFIYASIVIPYPTEHSFGLLKSLKSKGLKLENSQQQLKDEINNQDVKKN
AFMAYADLASRIRSVKIQREIVKEIITRIGESTTLTELTTNFHALNNAGKAVQVEILEVF
LKDDRIPDTIKTLIVENLKKRLKDENELDEMVHSILGSTGYSPTLKSSLINAQSEREKHL
RRGQSIPHVVSLHRKSKNEEIRTSIRNYLYTVGTDQAGDELAKMLKLSRPNKKQSMKKLY
QQSLKKQHASNTLSNLLSEDDMELLDSIHDVEQNVLFRRFFRRLGRAFRRVGSAIRRAAR
RVGGHLRRLGSRIKNIARKVGRSIGRIAKAVAKGVVKAVNWIKDKILAAINAVKKIVEKI
KYYFSAAKFENQKACMQVSVKSDDQLCLYHPGMIEFVRKQGDLSNIKKAKHFSFEKLLGT
NAVHMYMGFLVYAGASFECSAEKTGFDFVLLAKANMYAKLFKKELVVIDASAELTKRPDQ
PINDNVYVKVFQTTFINTNFVPERIRKIIEACFSETKPLIEKRFPKLVDYHYQFSIGPIP
VNFNFNVALNMGVELRYGVCVEKLEASASVEPYISLSVTGSANVGIPVAKVGVYLKATIT
YRIVPRLAFEKCNLCAMLQHKLDGVTFDVGLTAAFMKWKKEWKFFRQQTKGYVKTLFEKC
IGAGNYKPSDNDSKKLEFTSQRSPSNDQSSQQQEQPSSDATNSNDQSSQQQQQEQQQPTM
EEQQQKAESAAKNPEGYQNNIPELANLKSKVDSPEELQKIAQEKGVGDWAKKTSQYKSMF
GPKAERIPLSGGKPPKPSKQSLKRPVTTQKVKAWTSEFLREHVPQEVLEKVGIEKLRHLP
DEYFHLKMEDRAKIPNEILTVPPEDLKHFIEHLPNRYNKKTDFNPPKSAFTHVWSTEVLQ
KRLPKSVMEQVGIEYLRNLPEEILQIRTRVLEKIPISIYKSGNQAIVNWICSNYKHLCSR
LVKLIKSDTGKDMTPTSTEPAQQEQQPTTQQPSQQQPTTTPQPVEEQQQQQQPIVRNYTS
APRQRPIQYREDIGSGGGRRRPVRIDLNVNINKKPQ
Download sequence
Identical sequences D2VBR3
jgi|Naegr1|79341|estExt_fgeneshNG_pg.C_170218 XP_002678697.1.8020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]