SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Naegr1|80189|estExt_fgeneshNG_pg.C_320051 from Naegleria gruberi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Naegr1|80189|estExt_fgeneshNG_pg.C_320051
Domain Number 1 Region: 6-216
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.55e-49
Family DBL homology domain (DH-domain) 0.0000694
Further Details:      
 
Weak hits

Sequence:  jgi|Naegr1|80189|estExt_fgeneshNG_pg.C_320051
Domain Number - Region: 610-639
Classification Level Classification E-value
Superfamily SH3-domain 0.0571
Family SH3-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Naegr1|80189|estExt_fgeneshNG_pg.C_320051
Sequence length 895
Sequence
MSSAASRKRQKIFEEIIETEEEYVNNLEILSVVYEKPLQEKGEEVGCSKSLHIKVFNDLG
PIRITNGRLLADLKKLMEEEKQTGKKPEQTIGEIFLRYAPFMKSYTTYCNQYNNIATALR
VAKKEHPELDKFLTSQQKSGLHGVNNRALNSFLILPVQRIPRYKMLLSELLSKTSQYHKD
FASLTEALKAVSDIADYVNEKIRAYESEERLVSLFTLFEDDMKMDGIDEKELKEKHTRKF
QCEVLKNVKFFSYSKHLKLQKVNLYLFNDLILVSIPPPPVVPQTDEKKKVKEEEPVQEKY
LCRIHLDSSPYPWLRDIADKFIPELSLGMGSFGFDSQMARVRNTLSTPTSPAYGGSGHLL
STPSTASVGGILVGSHTSLVVPSNDKDRRASTDSLSSTNSSFSIFDNLEIVGLNNAFQVI
AHDDVYVFDFPDFDMKVKYITQITDNIHEYAKNATSLEYAIVHNSGLIPYPFYTNLSYLT
QKLANEERRKSKRSNSGGANKLNQDSPTLQSSSSQQTEPKKKGGFLRFFKSKKHLGGENT
EKTKYNDVELDPNEINPDEIPKVSSSDIPSESRLEVVKGRDLEERFYIAQAMNTYRPHRF
FNGKGVGQTDSQGVMSFHRGDVLIVFEKPNTDFVLVKKAGLNSDPDRKQKILESYIPRDF
ETLKILMNTQRNREGINAGDPPAVKQLRRIKHSFIQIRDLNNELLEYYSSSSSKDMAVNV
RNSTSTLINNNKGDDLIQKMDLLSLFEASEQKKKTTSSSNFEKDQVLSKVSARKSLSSIF
GTDSTKGYANDEEESLFRNLINLYEEWNEVGLVPVKYIEEFKSTSTSSKLAKLIEWRNEQ
EDRKVRNFVIKKKKPTKAVEVDDLGISCSIAVSGIPRIDTINEKEVAAIIKKSKK
Download sequence
Identical sequences D2VJF9
jgi|Naegr1|80189|estExt_fgeneshNG_pg.C_320051 XP_002675681.1.8020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]