SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338174786|ref|YP_004651596.1| from Parachlamydia acanthamoebae UV-7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338174786|ref|YP_004651596.1|
Domain Number 1 Region: 274-486
Classification Level Classification E-value
Superfamily RNI-like 1.1e-33
Family Cyclin A/CDK2-associated p19, Skp2 0.021
Further Details:      
 
Domain Number 2 Region: 72-195
Classification Level Classification E-value
Superfamily POZ domain 0.0000785
Family BTB/POZ domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|338174786|ref|YP_004651596.1|
Sequence length 493
Comment f-box/LRR-repeat protein 2 [Parachlamydia acanthamoebae UV-7]
Sequence
MPAFLPSELMYLSSSEEDEPLFHKVKENIYVFNAFFDASVEDGEWLLRHNEFLRLGLEWV
TEQFATDRIPFHISKNIGKKIRQHFSQLELSIPLDLTCHVGERHLETNSLLFGTASDFLH
DFFLKECLGKTRPSIITLRGVEWDVLTTLTEWMKFGEIPSLWKREEKFLWSVLKQATTWE
MTPVAELTQEVLTRYLNRANIYDHLILTHEQGWRFLKHACCDLINGLGLSVRVFEPGENG
LGLEFLEFNHHSLDVFDRLQKWITHLAFSLSLTEDVSFSEVLQKCPKLIGLDVSRTRIFT
ERLYDIPSFIEELDISMCAWLTPANLRKMIGICPHLIRLNVSSNGQITAAGWAELYQLQS
LEFLDISRCHQISDEDLKLILKACLQLTEFRMEECDKVTDIGFLNLAMNIPKILTLSLAR
CSLGDASLIEMGIRCTFLQRLNLTRCENVTDKGVIEMVRQAKSLRELILTHCFISPEITE
EIHRLRPLLKVVE
Download sequence
Identical sequences F8KY04
gi|338174786|ref|YP_004651596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]