SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338175972|ref|YP_004652782.1| from Parachlamydia acanthamoebae UV-7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338175972|ref|YP_004652782.1|
Domain Number 1 Region: 147-333
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.96e-57
Family Methylesterase CheB, C-terminal domain 0.0000296
Further Details:      
 
Domain Number 2 Region: 9-104
Classification Level Classification E-value
Superfamily CheY-like 0.000000000000897
Family CheY-related 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|338175972|ref|YP_004652782.1|
Sequence length 346
Comment chemotaxis response regulator CheB [Parachlamydia acanthamoebae UV-7]
Sequence
MRIGIAYGDERIAQVLNRLILNHSDHEVVWIACSSTQVFEKAIDEKPDLILLDLNIPSTG
GVEATRRMMKQAPCALLLLVQSVNWRSAEIFEAMGYGALDVLAMQTSIGEIEKEALLKKI
ETIGLLIGHHYNRKKSGINIHGKKASRLPHLVLIGASTGGPLALAKLLADFPQHSSLAIV
AIQHVDEKFAAGFANWLDRQISLEVKIADQGTQPEEGFVLVAGTNHHLIMNQKLELVYAP
NPLDSPYRPSVDVLFNSVAEHWPNRGVAVLLTGMGSDGAKGLKRLHDLGWHTIAQREESC
VVYGMPKAAVDLAAVRETLQLEKIADSIKSYFNLNPVTRTKRGLYE
Download sequence
Identical sequences F8L109
WP_013925293.1.96470 gi|338175972|ref|YP_004652782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]