SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338176365|ref|YP_004653175.1| from Parachlamydia acanthamoebae UV-7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338176365|ref|YP_004653175.1|
Domain Number 1 Region: 17-213
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.39e-51
Family PP-loop ATPase 0.00094
Further Details:      
 
Weak hits

Sequence:  gi|338176365|ref|YP_004653175.1|
Domain Number - Region: 372-400
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000366
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|338176365|ref|YP_004653175.1|
Sequence length 426
Comment tRNA(Ile)-lysidine synthase [Parachlamydia acanthamoebae UV-7]
Sequence
MEEIVLRFLKMRCDEARPILVGLSGGPDSIALLYLLLKCAKMIPLKLGIAHIDHRWRQES
EKEAETLKTLAESLHVPFHLKVLDPTSMHGNLEAACRDLRYQFFAEVAAIYDYQAVVLGH
HQDDQAETILKRILEGASLVKLRGIAETKQQGGLAIWRPLLEVDKAKILSWLSKHDIPFF
NDSTNLDPKFLRGKMRSRMMPYLAKEFGKEIKSALLYLGKESEELEHFFQTHLQPYFEKI
LRTPIGVWVDLSQKQPGTSFELKQLLRYVLSEEGISFSRSQMDVAVKCIREKRANCCIEA
GDHEVQFDRGNIFIGKKLWADWKVAYEFVESDEKDLKLPTWRDVWQGHFFAIIPWSDDCK
VDLPVTGTANWLDKWWTNHKVPAFMRWKIPVVWQNNRIVYEFLSGKMNTNHDKMRKWAKV
TLEYSI
Download sequence
Identical sequences A0A0C1BZY8 F8L206
gi|338176365|ref|YP_004653175.1| WP_013925518.1.86004 WP_013925518.1.96470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]