SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194335057|ref|YP_002016917.1| from Prosthecochloris aestuarii DSM 271

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194335057|ref|YP_002016917.1|
Domain Number 1 Region: 247-581
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 7.45e-93
Family beta-Lactamase/D-ala carboxypeptidase 0.0000167
Further Details:      
 
Domain Number 2 Region: 64-246
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 3.66e-35
Family Penicillin binding protein dimerisation domain 0.0026
Further Details:      
 
Domain Number 3 Region: 610-665
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000432
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|194335057|ref|YP_002016917.1|
Sequence length 680
Comment peptidoglycan glycosyltransferase [Prosthecochloris aestuarii DSM 271]
Sequence
MKIHNIGHRQSPSARSGGKEFGMRLGILSLGYALFFVAIVLRLLNIQVIDVKKYKNKASR
QYQRDVVEQAKRGVVMDRNGHLLAQSVQTISFYADPWLVANTEVKVGRKKVAVDKTPDVA
RLFAQRFGKSREHYMRILRNGQKQKRRFIWLERSVPVEHARELMETAMTGIDFKKEQYRY
YLNLAPQVVGLVNTDNKGISGLEIKYDHELRGRDGMKIFQRSATGTRFLAADADQVSAKE
GLSLQLTLDADMQSIVESEIASAAKEFNASAAVGIVMDVKTGAILAMANYPTFDMNNRKG
FRESDARNRAIIDAFDPGSTFKIVMASAAREVLHRAAEDSVDAHNGVFHIYNRTIRDHEK
FERCTFRDAMVHSSNIVAAKTAMELGEKTFYDYVRRFGFGEQTGIGLVGESEGIVRPLKQ
WNKTTLPWMGYGYSVTTTPLQILQAYAAIANDGVLMKPYIVERLVDADGNAVSEFKPEKV
RNVVSAETARYIRKEYLQPIVEEGTGVAAAVKGVTVGGKTGTAQKLSNGNYNRGPRSYIA
SFVGFFPVDEPRIAAIIVVDEPQSAYYASTVAAPSFARICTRMIACSEDLKADLGMTAPE
AVVLAASKSVAVPLLTGLKARDAEKLLIWNGLDISMNGDREGVVVEQDIAAGSMVEPGSR
VRVGLSAQENQDPGSKSSVM
Download sequence
Identical sequences B4S6R5
gi|194335057|ref|YP_002016917.1| WP_012506800.1.66998 290512.Paes_2269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]