SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000006242 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000006242
Domain Number 1 Region: 158-355
Classification Level Classification E-value
Superfamily E set domains 3.5e-74
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000006242   Gene: ENSETEG00000007687   Transcript: ENSETET00000007687
Sequence length 382
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_5079:199418:203522:-1 gene:ENSETEG00000007687 transcript:ENSETET00000007687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDASSWNMLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPEFHPRSNHPCVEI
NAPSAQFSLTVTIGYGFRCVTEQCGTAIFLLIFQSILGVIINSFMCGAILAKISRSKKRA
KTITFSKHAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLRTTVTPEGETIILDQINI
NFVVDAGNENLFFISPLTIYHIIDHNSPFFHMSAETLLQQDFELVVFLDGTVESTSATCQ
VRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDARARM
KRGYDNPNFILSEVNETDDTKM
Download sequence
Identical sequences ENSETEP00000006242 ENSETEP00000006242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]