SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000006313 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000006313
Domain Number 1 Region: 866-1074
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.76e-55
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 1237-1423
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-26
Family Pleckstrin-homology domain (PH domain) 0.0000059
Further Details:      
 
Domain Number 3 Region: 1063-1183
Classification Level Classification E-value
Superfamily PH domain-like 1.16e-24
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000006313   Gene: ENSETEG00000007769   Transcript: ENSETET00000007769
Sequence length 1427
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_7454:3712:250201:-1 gene:ENSETEG00000007769 transcript:ENSETET00000007769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSAAEIKKPPLAPKPKFAMANNKPVPPPVAPKPDLVVSSPQQSTRKTKPAIAPKPKVLK
DSPVRESRPLPARKNTVNLDKHQQKVPGEDAEDHNCTHAAEQSSDYISPMCSSCSSGCAH
KLGNRGNLCGEQLLLEPLELCENVGNSRTDEFSSSVKGESQCDSCGEKTKSQSGVILKAN
ATDKNLEDVLTQGTTPIGTPQNHRPPDNPEMNGSCHSNKQFRIEYGDSSSSSSSSSFEKV
PDSRHLPQPPNEEFQIVETCQEGHEKGSSSCHHASENVKRNDFIPADRVSEALEVKDHGP
LEIHLVPYTKKFPTPKPRKTRTACLTRQKYIDAPSESIEEPDNSDGSSSGLSDKHLKKNK
GSVLCQNALCNQKQVDKVKQGNASELNADSDCERQDLAHSQKAGCPETSSVEEMASPLDK
DSSKTEDSCSPSLAVDNETTFIRCSTLSMSLPKQLKLTCDKHLPTACNPVVPAPEVQKES
TVKDEASSRVVPKKPQRHSLPAAGVLKKAASEELVEKSSYPSDGEKTSGRSLERNHVQHL
CAQHQGMSSSFDGPKRTSEKPVWKLPHPILPFSGKPESLKSVRMSSNSGSSATQIKPRAK
SLSAVDVVRSTKPCKDTPKKNSFKKLLNLKLSICFMKSDFQKLWSKSSQLGDTTAGSFCG
GEQKRTESHCHGLLVGEEKRRKPTKAHSADHYSLESQKKKKSWDYPSMANGPRAESLDDR
MLSRESSPQAPCTLVTGASAPEYENICHYEEIPEYENLPFVLVVGKTPESACQNSGSMED
TDANMYEIEDPYEVPASQLQLIPGLQHCSSGATQEGHHDLDLRLEDLPSEEEEATNSSDE
DDISSGSSKGEPDPLDDKQGDDTGVKSKVYHIAKEIMSSEKVFVDVLKLLHIDFRDAVTH
ASRLLGKPVIEDRILNQILYYLPQLYELNRDLLKELEERMLNWTEQQRIADIFVKKGPYL
KMYSTYIKEFDKNIALLDEQCKKNPAFAAVVRDFELNPRCASLALKHYLLKPVQRIPQYK
LLLTDYLKNLLEDSGDYRDTQDALAVVIEVANHANDTMKQGDNFQKLMQIQYSLNGHHEI
VQPGRVFLKEGILMKVSRKVMHPRMFFLFNDALLYTTPVQSGMFKLNNMLSLAGMKVRKP
TQEAYQNELKIESVERSFILSASSATERDEWLEAISRSIEEYAKKRITFCPSRSLDEADS
ENKEEVSPLGSKAPIWIPDTRVTMCMICTSEFTLTWRRHHCRACGKIVCQACSSNKYGLD
YLKNQPARVCEHCFQELQKLDHQHTPKVGSPGNHKSPSSALSSVLHSIPSGRKQKKIPAA
LKEVSANTEDSSMSGYLYRSKGNKKPWKHLWFVIKNKVLYTYAASEDVAALESQPLLGFT
VTHVKDENSESKVFQLLHKNMLFYVFKAEDSHSAQKWIEAFQEGTIL
Download sequence
Identical sequences ENSETEP00000006313 ENSETEP00000006313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]