SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSETEP00000016002 from Echinops telfairi 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSETEP00000016002
Domain Number 1 Region: 222-301
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000153
Family Fibronectin type III 0.0000301
Further Details:      
 
Domain Number 2 Region: 409-595
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000423
Family Fibronectin type III 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSETEP00000016002
Domain Number - Region: 330-404
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00232
Family Fibronectin type III 0.0093
Further Details:      
 
Domain Number - Region: 4-50
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00615
Family C2 set domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSETEP00000016002   Gene: ENSETEG00000019701   Transcript: ENSETET00000019701
Sequence length 629
Comment pep:known_by_projection genescaffold:TENREC:GeneScaffold_2739:256:7992:-1 gene:ENSETEG00000019701 transcript:ENSETET00000019701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEECGDISLSDPVVRLGNPITASWLFRLNGSPEPKPEISWKLESKHQPWXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXKLQPPILRALEPSPGGAPALPGCLWLSWETHNSSWFMR
KKCELRYQPRLAEANWALVTPLPSKSLHHELCGLLPATAYILQMRCVRWPLPGHWSDWSP
SLERNATERAPNVRLDTRWRQRQLDPRTVEVQLFWKPRLLEEDSGQIQGYLVSGRPSAQA
GAAPLLCNTAALNCTFRLPPEAREVALVAYNTGGTSQPTPVVFMESRGPPLARLHAVARD
PHSIWVGWEPSRPRPQGYVIEWGLGPPSPNPSNRNWRVEHNGSIPGTLLQXXXXXXXXYE
ITVKALYQDTGPSQNIYAYSEKNPPRVPELHLKHIAKTWAQLEWVPEAPELGKSPLTHYT
IFWTNAQNRSFSAVLNTSVSDVILHDLEPASLYHVHLMATSRAGAANSTGLTLVTLALEE
SELHILLGMFGLLLFLTSLCGAAWLCCSP
Download sequence
Identical sequences ENSETEP00000016002 ENSETEP00000016002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]