SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29377150|ref|NP_816304.1| from Enterococcus faecalis V583

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29377150|ref|NP_816304.1|
Domain Number 1 Region: 1-208
Classification Level Classification E-value
Superfamily CutC-like 7.59e-62
Family CutC-like 0.0000366
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|29377150|ref|NP_816304.1|
Sequence length 209
Comment copper homeostasis protein [Enterococcus faecalis V583]
Sequence
MIKEFCAENFTKIPQAIQKGANRIELCDNLAVGGTTPSTGVIEEVLAYAGEHSVPVMTII
RPRGGNFVYNDIELKIMHTDLIEAKKLGTDGIVIGCLTEDGWLDEEALDLFIETAEGLQI
TFHMAFDALSKENQFKAIDWLAERGVTRILTHGGPAGTPIEDNFDHLKELIVYADQRILI
LPGGGISTENVQTVMDTLKVTEVHGTKIV
Download sequence
Identical sequences A0A059N4X9 A0A0M2A9G1 A0A0U1APP0 A0A0Y4CF64 A0A125W2R8 A0A1R4KTW4 A0A1Y0M287 C7VB44 E2YS97 E6EUP0 E6GMA5 E6GXS2 E6H6K7 Q830V2
gi|397700796|ref|YP_006538584.1| 226185.EF2667 gi|428767817|ref|YP_007153928.1| APC29491 EfR34 gi|384519462|ref|YP_005706767.1| gi|29377150|ref|NP_816304.1| NP_816304.1.90627 WP_002356490.1.100343 WP_002356490.1.100415 WP_002356490.1.100482 WP_002356490.1.101272 WP_002356490.1.101818 WP_002356490.1.101914 WP_002356490.1.102128 WP_002356490.1.10330 WP_002356490.1.10696 WP_002356490.1.11193 WP_002356490.1.11284 WP_002356490.1.11459 WP_002356490.1.12625 WP_002356490.1.12630 WP_002356490.1.1291 WP_002356490.1.12926 WP_002356490.1.13739 WP_002356490.1.14157 WP_002356490.1.14180 WP_002356490.1.14792 WP_002356490.1.15286 WP_002356490.1.1595 WP_002356490.1.16241 WP_002356490.1.16763 WP_002356490.1.17164 WP_002356490.1.17287 WP_002356490.1.17682 WP_002356490.1.17799 WP_002356490.1.1799 WP_002356490.1.18048 WP_002356490.1.18259 WP_002356490.1.18260 WP_002356490.1.18390 WP_002356490.1.18475 WP_002356490.1.18709 WP_002356490.1.1948 WP_002356490.1.19601 WP_002356490.1.20659 WP_002356490.1.2067 WP_002356490.1.20674 WP_002356490.1.21993 WP_002356490.1.22059 WP_002356490.1.2207 WP_002356490.1.22796 WP_002356490.1.23054 WP_002356490.1.23319 WP_002356490.1.23569 WP_002356490.1.23904 WP_002356490.1.24064 WP_002356490.1.24526 WP_002356490.1.2486 WP_002356490.1.25180 WP_002356490.1.25583 WP_002356490.1.25669 WP_002356490.1.25979 WP_002356490.1.26451 WP_002356490.1.274 WP_002356490.1.2799 WP_002356490.1.28817 WP_002356490.1.28932 WP_002356490.1.29097 WP_002356490.1.3016 WP_002356490.1.30609 WP_002356490.1.31326 WP_002356490.1.31656 WP_002356490.1.31869 WP_002356490.1.32099 WP_002356490.1.321 WP_002356490.1.32385 WP_002356490.1.33139 WP_002356490.1.33306 WP_002356490.1.33460 WP_002356490.1.33574 WP_002356490.1.33685 WP_002356490.1.33798 WP_002356490.1.34192 WP_002356490.1.35171 WP_002356490.1.35283 WP_002356490.1.35810 WP_002356490.1.35823 WP_002356490.1.36198 WP_002356490.1.3645 WP_002356490.1.36880 WP_002356490.1.36900 WP_002356490.1.37850 WP_002356490.1.38784 WP_002356490.1.39119 WP_002356490.1.4014 WP_002356490.1.4071 WP_002356490.1.40757 WP_002356490.1.42483 WP_002356490.1.42904 WP_002356490.1.43540 WP_002356490.1.43903 WP_002356490.1.44185 WP_002356490.1.44242 WP_002356490.1.44501 WP_002356490.1.44626 WP_002356490.1.45643 WP_002356490.1.45925 WP_002356490.1.46056 WP_002356490.1.46113 WP_002356490.1.46346 WP_002356490.1.46348 WP_002356490.1.46606 WP_002356490.1.47172 WP_002356490.1.47407 WP_002356490.1.47539 WP_002356490.1.47856 WP_002356490.1.47867 WP_002356490.1.49131 WP_002356490.1.4975 WP_002356490.1.50067 WP_002356490.1.50513 WP_002356490.1.5083 WP_002356490.1.50938 WP_002356490.1.51046 WP_002356490.1.52614 WP_002356490.1.52926 WP_002356490.1.54795 WP_002356490.1.55065 WP_002356490.1.56483 WP_002356490.1.57048 WP_002356490.1.57136 WP_002356490.1.57163 WP_002356490.1.57211 WP_002356490.1.57542 WP_002356490.1.57671 WP_002356490.1.58620 WP_002356490.1.58766 WP_002356490.1.59564 WP_002356490.1.59690 WP_002356490.1.59698 WP_002356490.1.5994 WP_002356490.1.59964 WP_002356490.1.60361 WP_002356490.1.60394 WP_002356490.1.60579 WP_002356490.1.61083 WP_002356490.1.61089 WP_002356490.1.61180 WP_002356490.1.61503 WP_002356490.1.62847 WP_002356490.1.6312 WP_002356490.1.63148 WP_002356490.1.63158 WP_002356490.1.63477 WP_002356490.1.63507 WP_002356490.1.63848 WP_002356490.1.63884 WP_002356490.1.64483 WP_002356490.1.6473 WP_002356490.1.65210 WP_002356490.1.65397 WP_002356490.1.6626 WP_002356490.1.66316 WP_002356490.1.6682 WP_002356490.1.66843 WP_002356490.1.66845 WP_002356490.1.66898 WP_002356490.1.67683 WP_002356490.1.67716 WP_002356490.1.6893 WP_002356490.1.69290 WP_002356490.1.69648 WP_002356490.1.70043 WP_002356490.1.70799 WP_002356490.1.71303 WP_002356490.1.71406 WP_002356490.1.71499 WP_002356490.1.71510 WP_002356490.1.72077 WP_002356490.1.72635 WP_002356490.1.73695 WP_002356490.1.75949 WP_002356490.1.76074 WP_002356490.1.76646 WP_002356490.1.77327 WP_002356490.1.77328 WP_002356490.1.77357 WP_002356490.1.77956 WP_002356490.1.7815 WP_002356490.1.7819 WP_002356490.1.78447 WP_002356490.1.78471 WP_002356490.1.78503 WP_002356490.1.78641 WP_002356490.1.79457 WP_002356490.1.7958 WP_002356490.1.80104 WP_002356490.1.80452 WP_002356490.1.8058 WP_002356490.1.81327 WP_002356490.1.81575 WP_002356490.1.81991 WP_002356490.1.82160 WP_002356490.1.82993 WP_002356490.1.83032 WP_002356490.1.83490 WP_002356490.1.8380 WP_002356490.1.83953 WP_002356490.1.84260 WP_002356490.1.84380 WP_002356490.1.84632 WP_002356490.1.85534 WP_002356490.1.86134 WP_002356490.1.87277 WP_002356490.1.8794 WP_002356490.1.89431 WP_002356490.1.8960 WP_002356490.1.90371 WP_002356490.1.90503 WP_002356490.1.90642 WP_002356490.1.90872 WP_002356490.1.91092 WP_002356490.1.91394 WP_002356490.1.91555 WP_002356490.1.9159 WP_002356490.1.92581 WP_002356490.1.93277 WP_002356490.1.93642 WP_002356490.1.94506 WP_002356490.1.94630 WP_002356490.1.95143 WP_002356490.1.95212 WP_002356490.1.95534 WP_002356490.1.9570 WP_002356490.1.95935 WP_002356490.1.95970 WP_002356490.1.96320 WP_002356490.1.96481 WP_002356490.1.96745 WP_002356490.1.97078 WP_002356490.1.97828 WP_002356490.1.9842 WP_002356490.1.98652 WP_002356490.1.98868 WP_002356490.1.99 WP_002356490.1.9925 WP_002356490.1.99432 gi|384514001|ref|YP_005709094.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]