SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29374687|ref|NP_813839.1| from Enterococcus faecalis V583

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29374687|ref|NP_813839.1|
Domain Number 1 Region: 6-388
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.39e-85
Family Cystathionine synthase-like 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|29374687|ref|NP_813839.1|
Sequence length 404
Comment class II aminotransferase [Enterococcus faecalis V583]
Sequence
MKSVSFDKAIDRRGTYCTQWDFVEDRFGEADLLPFTISDTDFAVPEAVLATLQERLNHPV
FGYTRWNHPQLKEAIQTWYQTRFQTKIEEHWIMYTPTVIYGISALIQLLTNEGEGIILQT
PAYDAFFKVIQENKRQVVANELLYQEKRYSIDFIDLEKKLAQPENRCLLLCSPHNPTGRV
WEQWELERIVSLCQQYDVFLLSDEIHMDIVNKGHVHRPITQFDYKKSAIITSGTKTFNFP
GLIFAYALIPDNELRDAFQLKLKNADGLSSTSILGMLATMTAYQKCGTWVDELNDYLAEN
QRYVKDFLQTYLPKIKVTELEATYLMWLDVSAAVPDVARLQAALVSVGKVAIMDGSIYGG
NGQRFLRLNIGCSQAKLHEGLERMRQGFEAVLQKDGTASALRNN
Download sequence
Identical sequences A0A059N0M2 E6GTI2 E6H6F3 Q839X1
gi|29374687|ref|NP_813839.1| NP_813839.1.90627 WP_002399716.1.100343 WP_002399716.1.100482 WP_002399716.1.101272 WP_002399716.1.101818 WP_002399716.1.10696 WP_002399716.1.11193 WP_002399716.1.12926 WP_002399716.1.13369 WP_002399716.1.13739 WP_002399716.1.14157 WP_002399716.1.14180 WP_002399716.1.16241 WP_002399716.1.16763 WP_002399716.1.17287 WP_002399716.1.17799 WP_002399716.1.18048 WP_002399716.1.18260 WP_002399716.1.20659 WP_002399716.1.23054 WP_002399716.1.23569 WP_002399716.1.24064 WP_002399716.1.25180 WP_002399716.1.274 WP_002399716.1.2799 WP_002399716.1.28932 WP_002399716.1.31656 WP_002399716.1.32099 WP_002399716.1.33306 WP_002399716.1.33460 WP_002399716.1.33574 WP_002399716.1.35810 WP_002399716.1.35823 WP_002399716.1.36900 WP_002399716.1.39119 WP_002399716.1.4014 WP_002399716.1.42483 WP_002399716.1.43903 WP_002399716.1.44185 WP_002399716.1.44242 WP_002399716.1.44626 WP_002399716.1.45925 WP_002399716.1.46056 WP_002399716.1.46348 WP_002399716.1.47407 WP_002399716.1.47856 WP_002399716.1.47867 WP_002399716.1.49131 WP_002399716.1.50938 WP_002399716.1.52926 WP_002399716.1.55065 WP_002399716.1.57048 WP_002399716.1.57136 WP_002399716.1.57211 WP_002399716.1.57542 WP_002399716.1.58620 WP_002399716.1.59698 WP_002399716.1.59964 WP_002399716.1.60361 WP_002399716.1.60394 WP_002399716.1.61083 WP_002399716.1.62847 WP_002399716.1.63148 WP_002399716.1.63507 WP_002399716.1.63848 WP_002399716.1.63884 WP_002399716.1.6473 WP_002399716.1.66316 WP_002399716.1.66843 WP_002399716.1.66898 WP_002399716.1.69648 WP_002399716.1.70799 WP_002399716.1.77328 WP_002399716.1.7819 WP_002399716.1.78503 WP_002399716.1.78641 WP_002399716.1.7958 WP_002399716.1.80104 WP_002399716.1.80452 WP_002399716.1.81327 WP_002399716.1.81575 WP_002399716.1.82993 WP_002399716.1.83490 WP_002399716.1.8380 WP_002399716.1.84260 WP_002399716.1.86134 WP_002399716.1.90371 WP_002399716.1.90503 WP_002399716.1.90872 WP_002399716.1.91394 WP_002399716.1.93277 WP_002399716.1.95534 WP_002399716.1.9570 WP_002399716.1.96481 WP_002399716.1.96745 WP_002399716.1.97078 WP_002399716.1.98868 WP_002399716.1.99 WP_002399716.1.9925 WP_002399716.1.99432 226185.EF0029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]