SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29374929|ref|NP_814082.1| from Enterococcus faecalis V583

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29374929|ref|NP_814082.1|
Domain Number 1 Region: 3-377
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.64e-120
Family Cystathionine synthase-like 0.000000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|29374929|ref|NP_814082.1|
Sequence length 378
Comment cystathionine gamma-synthase [Enterococcus faecalis V583]
Sequence
MKFNTKLIHGGISKDTTTGAVSVPIYQTSTFEQNGVGQPKEYEYSRSGNPTRHALETLIA
ELEGGSHGFAFSSGLAGIHAIISMFGPEDHILLGDDVYGGSFRLLDKVFVANGLSYTIVN
ASDLSTIEAAIQPNTKALFLETPSNPLLKITDIEAAAKLAKKHQLLTIVDNTFATPYFQR
PLALGADIVVHSGTKYLGGHSDVVSGLVVTNHPESAEKIAFLQNAIGAVLGPHDSWLVQR
SLKTLGVRMAAHAQNAQKIAEFLEAHPAVATVYYPGLASHPGHEIAQKQMSGFSGMISFE
LAKDEQVVPFVEALEIFTLAESLGGVESLIEVPAIMTHASIPKENREAVGIKDGLIRLSV
GIEAVEDLLADLEKGLQA
Download sequence
Identical sequences A0A0E9EJQ8 A0A0M2AEG7 A0A0U1AT40 A0A1J6XRW3 C7CWL5 C7V818 C7WV54 Q838Z2
gi|29374929|ref|NP_814082.1| NP_814082.1.90627 WP_002358342.1.100343 WP_002358342.1.100482 WP_002358342.1.101272 WP_002358342.1.101275 WP_002358342.1.101818 WP_002358342.1.10330 WP_002358342.1.10696 WP_002358342.1.10758 WP_002358342.1.11048 WP_002358342.1.11193 WP_002358342.1.11284 WP_002358342.1.12625 WP_002358342.1.12630 WP_002358342.1.12889 WP_002358342.1.12926 WP_002358342.1.13021 WP_002358342.1.13365 WP_002358342.1.13739 WP_002358342.1.14157 WP_002358342.1.14180 WP_002358342.1.14269 WP_002358342.1.14402 WP_002358342.1.14420 WP_002358342.1.16241 WP_002358342.1.16763 WP_002358342.1.17164 WP_002358342.1.17287 WP_002358342.1.17799 WP_002358342.1.17800 WP_002358342.1.1799 WP_002358342.1.18048 WP_002358342.1.18260 WP_002358342.1.18390 WP_002358342.1.19165 WP_002358342.1.19601 WP_002358342.1.19734 WP_002358342.1.19902 WP_002358342.1.20659 WP_002358342.1.2067 WP_002358342.1.2171 WP_002358342.1.23017 WP_002358342.1.23054 WP_002358342.1.23322 WP_002358342.1.23498 WP_002358342.1.23569 WP_002358342.1.24059 WP_002358342.1.24064 WP_002358342.1.246 WP_002358342.1.25180 WP_002358342.1.25583 WP_002358342.1.25704 WP_002358342.1.26187 WP_002358342.1.26451 WP_002358342.1.274 WP_002358342.1.2799 WP_002358342.1.2801 WP_002358342.1.28428 WP_002358342.1.28579 WP_002358342.1.28932 WP_002358342.1.28980 WP_002358342.1.29097 WP_002358342.1.30609 WP_002358342.1.31324 WP_002358342.1.31656 WP_002358342.1.32099 WP_002358342.1.321 WP_002358342.1.32385 WP_002358342.1.33139 WP_002358342.1.33306 WP_002358342.1.33460 WP_002358342.1.33513 WP_002358342.1.33574 WP_002358342.1.33581 WP_002358342.1.33851 WP_002358342.1.34192 WP_002358342.1.34766 WP_002358342.1.34947 WP_002358342.1.35171 WP_002358342.1.35449 WP_002358342.1.35810 WP_002358342.1.35823 WP_002358342.1.36209 WP_002358342.1.3645 WP_002358342.1.36880 WP_002358342.1.36900 WP_002358342.1.37181 WP_002358342.1.37810 WP_002358342.1.38725 WP_002358342.1.3909 WP_002358342.1.39119 WP_002358342.1.4014 WP_002358342.1.41792 WP_002358342.1.42353 WP_002358342.1.42483 WP_002358342.1.42908 WP_002358342.1.43540 WP_002358342.1.43903 WP_002358342.1.43994 WP_002358342.1.44185 WP_002358342.1.44242 WP_002358342.1.44537 WP_002358342.1.44626 WP_002358342.1.4487 WP_002358342.1.45643 WP_002358342.1.45860 WP_002358342.1.45925 WP_002358342.1.46056 WP_002358342.1.46113 WP_002358342.1.46346 WP_002358342.1.46348 WP_002358342.1.46357 WP_002358342.1.46606 WP_002358342.1.46621 WP_002358342.1.47407 WP_002358342.1.47856 WP_002358342.1.47867 WP_002358342.1.48063 WP_002358342.1.48153 WP_002358342.1.48676 WP_002358342.1.49131 WP_002358342.1.49646 WP_002358342.1.4975 WP_002358342.1.49914 WP_002358342.1.50067 WP_002358342.1.50115 WP_002358342.1.50160 WP_002358342.1.5083 WP_002358342.1.50938 WP_002358342.1.5113 WP_002358342.1.51694 WP_002358342.1.51712 WP_002358342.1.52575 WP_002358342.1.52926 WP_002358342.1.53279 WP_002358342.1.53342 WP_002358342.1.53989 WP_002358342.1.54277 WP_002358342.1.54652 WP_002358342.1.55065 WP_002358342.1.56483 WP_002358342.1.56974 WP_002358342.1.57048 WP_002358342.1.57136 WP_002358342.1.57211 WP_002358342.1.57242 WP_002358342.1.57542 WP_002358342.1.57671 WP_002358342.1.57705 WP_002358342.1.58620 WP_002358342.1.58766 WP_002358342.1.59564 WP_002358342.1.59645 WP_002358342.1.59698 WP_002358342.1.5994 WP_002358342.1.59964 WP_002358342.1.60200 WP_002358342.1.60220 WP_002358342.1.60361 WP_002358342.1.60394 WP_002358342.1.60776 WP_002358342.1.61083 WP_002358342.1.61103 WP_002358342.1.61932 WP_002358342.1.62847 WP_002358342.1.63148 WP_002358342.1.63507 WP_002358342.1.63848 WP_002358342.1.63884 WP_002358342.1.64022 WP_002358342.1.6473 WP_002358342.1.66308 WP_002358342.1.66316 WP_002358342.1.66390 WP_002358342.1.66403 WP_002358342.1.66843 WP_002358342.1.66898 WP_002358342.1.66902 WP_002358342.1.67615 WP_002358342.1.67683 WP_002358342.1.68828 WP_002358342.1.69648 WP_002358342.1.70043 WP_002358342.1.70675 WP_002358342.1.70799 WP_002358342.1.71303 WP_002358342.1.71406 WP_002358342.1.71499 WP_002358342.1.71510 WP_002358342.1.75297 WP_002358342.1.75486 WP_002358342.1.76128 WP_002358342.1.76541 WP_002358342.1.76958 WP_002358342.1.77328 WP_002358342.1.77357 WP_002358342.1.7819 WP_002358342.1.78471 WP_002358342.1.78503 WP_002358342.1.78641 WP_002358342.1.7958 WP_002358342.1.79975 WP_002358342.1.80104 WP_002358342.1.80452 WP_002358342.1.81312 WP_002358342.1.81327 WP_002358342.1.81575 WP_002358342.1.82202 WP_002358342.1.82555 WP_002358342.1.82993 WP_002358342.1.83032 WP_002358342.1.83327 WP_002358342.1.83490 WP_002358342.1.8380 WP_002358342.1.84260 WP_002358342.1.84469 WP_002358342.1.84573 WP_002358342.1.84632 WP_002358342.1.84813 WP_002358342.1.85355 WP_002358342.1.85465 WP_002358342.1.8575 WP_002358342.1.85848 WP_002358342.1.85963 WP_002358342.1.86134 WP_002358342.1.86904 WP_002358342.1.87000 WP_002358342.1.87277 WP_002358342.1.87482 WP_002358342.1.8794 WP_002358342.1.88464 WP_002358342.1.8901 WP_002358342.1.89088 WP_002358342.1.8960 WP_002358342.1.90371 WP_002358342.1.90503 WP_002358342.1.90642 WP_002358342.1.90872 WP_002358342.1.91394 WP_002358342.1.91555 WP_002358342.1.91608 WP_002358342.1.91925 WP_002358342.1.92073 WP_002358342.1.92581 WP_002358342.1.93159 WP_002358342.1.93277 WP_002358342.1.93977 WP_002358342.1.94041 WP_002358342.1.94399 WP_002358342.1.94630 WP_002358342.1.95212 WP_002358342.1.95228 WP_002358342.1.95534 WP_002358342.1.9570 WP_002358342.1.95935 WP_002358342.1.96481 WP_002358342.1.96745 WP_002358342.1.96764 WP_002358342.1.96987 WP_002358342.1.97078 WP_002358342.1.97268 WP_002358342.1.98078 WP_002358342.1.98122 WP_002358342.1.9842 WP_002358342.1.98868 WP_002358342.1.99 WP_002358342.1.99014 WP_002358342.1.9925 WP_002358342.1.99432 WP_002358342.1.99543 gi|479181444|ref|YP_007808753.1| 226185.EF0290 gi|397698810|ref|YP_006536598.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]