SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29375009|ref|NP_814162.1| from Enterococcus faecalis V583

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29375009|ref|NP_814162.1|
Domain Number 1 Region: 1-376
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.04e-99
Family Cystathionine synthase-like 0.000000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|29375009|ref|NP_814162.1|
Sequence length 381
Comment class V aminotransferase [Enterococcus faecalis V583]
Sequence
MIYFDNSATTPIYPQALDTYVKTSQRIIGNPSSLHDLGSQANRLLQQARKQIAELINVSA
NEIYFTSGGTEGDNWVLKGTAIEKREFGNHIIISAVEHPAVTETAEQLVELGFELSYAPV
DKEGRVKVEELQKLIRKETILVSVMAVNNEVGTIQPIKEISEVLAEFPKIHFHVDAVQAI
GKVNYSEWLTDRVDFATFSAHKFHGPRGIGFMYWKQGKRLAPLLTGGGQENNQRSGTENV
PAIVAMAKALRLHLENEQQRPQHVATLRSYLLKALEEFQNVTVFSQDNEHFAPHILCFAL
KGIRGEVLVHALEEKQIYISTTSACSSRKKMASSTLYAMHVPGELATSAVRISLDESNTM
AEIEQFMIVFNQLYQKFSRVN
Download sequence
Identical sequences A0A059N3P5 A0A0U1AUU4 A0A1Q1FQU0 C7CWP1 C7WV79 D4EIK5 D4EX36 E2YB03 E2YJL8 E6GSL2 E6H418 Q838R4 S4ECD3 S4FGW5 X5NV52
gi|384512222|ref|YP_005707315.1| NP_814162.1.90627 WP_002358363.1.100343 WP_002358363.1.100482 WP_002358363.1.101272 WP_002358363.1.101818 WP_002358363.1.10696 WP_002358363.1.10758 WP_002358363.1.11193 WP_002358363.1.12449 WP_002358363.1.12625 WP_002358363.1.12926 WP_002358363.1.13739 WP_002358363.1.14157 WP_002358363.1.14180 WP_002358363.1.14402 WP_002358363.1.16241 WP_002358363.1.16763 WP_002358363.1.17287 WP_002358363.1.17799 WP_002358363.1.17800 WP_002358363.1.18048 WP_002358363.1.18260 WP_002358363.1.19601 WP_002358363.1.19902 WP_002358363.1.20659 WP_002358363.1.2067 WP_002358363.1.21993 WP_002358363.1.23054 WP_002358363.1.23322 WP_002358363.1.23498 WP_002358363.1.23569 WP_002358363.1.24059 WP_002358363.1.24064 WP_002358363.1.24743 WP_002358363.1.25180 WP_002358363.1.26187 WP_002358363.1.26451 WP_002358363.1.274 WP_002358363.1.2799 WP_002358363.1.28932 WP_002358363.1.28980 WP_002358363.1.31656 WP_002358363.1.32099 WP_002358363.1.32385 WP_002358363.1.33306 WP_002358363.1.33460 WP_002358363.1.33513 WP_002358363.1.33574 WP_002358363.1.33581 WP_002358363.1.34192 WP_002358363.1.34999 WP_002358363.1.35810 WP_002358363.1.35823 WP_002358363.1.36209 WP_002358363.1.36900 WP_002358363.1.37996 WP_002358363.1.3909 WP_002358363.1.39119 WP_002358363.1.39771 WP_002358363.1.4014 WP_002358363.1.41792 WP_002358363.1.42353 WP_002358363.1.42483 WP_002358363.1.43540 WP_002358363.1.43903 WP_002358363.1.44185 WP_002358363.1.44242 WP_002358363.1.44537 WP_002358363.1.44626 WP_002358363.1.45484 WP_002358363.1.45925 WP_002358363.1.46056 WP_002358363.1.46348 WP_002358363.1.46357 WP_002358363.1.46606 WP_002358363.1.46621 WP_002358363.1.47407 WP_002358363.1.47856 WP_002358363.1.47867 WP_002358363.1.48063 WP_002358363.1.48676 WP_002358363.1.49131 WP_002358363.1.50067 WP_002358363.1.50938 WP_002358363.1.5113 WP_002358363.1.52926 WP_002358363.1.55065 WP_002358363.1.57048 WP_002358363.1.57136 WP_002358363.1.57211 WP_002358363.1.57542 WP_002358363.1.57705 WP_002358363.1.58620 WP_002358363.1.59564 WP_002358363.1.59698 WP_002358363.1.5994 WP_002358363.1.59964 WP_002358363.1.60361 WP_002358363.1.60394 WP_002358363.1.60776 WP_002358363.1.61083 WP_002358363.1.61089 WP_002358363.1.62847 WP_002358363.1.6312 WP_002358363.1.63148 WP_002358363.1.63507 WP_002358363.1.63848 WP_002358363.1.63884 WP_002358363.1.6473 WP_002358363.1.66308 WP_002358363.1.66316 WP_002358363.1.66390 WP_002358363.1.66843 WP_002358363.1.66898 WP_002358363.1.67683 WP_002358363.1.68746 WP_002358363.1.69648 WP_002358363.1.70675 WP_002358363.1.71303 WP_002358363.1.71499 WP_002358363.1.72077 WP_002358363.1.76074 WP_002358363.1.76128 WP_002358363.1.76541 WP_002358363.1.76958 WP_002358363.1.77328 WP_002358363.1.7819 WP_002358363.1.78503 WP_002358363.1.78641 WP_002358363.1.7958 WP_002358363.1.79975 WP_002358363.1.80104 WP_002358363.1.80452 WP_002358363.1.81312 WP_002358363.1.81327 WP_002358363.1.81575 WP_002358363.1.82202 WP_002358363.1.82555 WP_002358363.1.82993 WP_002358363.1.83327 WP_002358363.1.83490 WP_002358363.1.8380 WP_002358363.1.84260 WP_002358363.1.84573 WP_002358363.1.84632 WP_002358363.1.84813 WP_002358363.1.85945 WP_002358363.1.86134 WP_002358363.1.86666 WP_002358363.1.86904 WP_002358363.1.87000 WP_002358363.1.87277 WP_002358363.1.8794 WP_002358363.1.90371 WP_002358363.1.90503 WP_002358363.1.90642 WP_002358363.1.90872 WP_002358363.1.91394 WP_002358363.1.91925 WP_002358363.1.92581 WP_002358363.1.93277 WP_002358363.1.94399 WP_002358363.1.94630 WP_002358363.1.95534 WP_002358363.1.9570 WP_002358363.1.95971 WP_002358363.1.96481 WP_002358363.1.96745 WP_002358363.1.96987 WP_002358363.1.97078 WP_002358363.1.98868 WP_002358363.1.99 WP_002358363.1.99014 WP_002358363.1.9925 WP_002358363.1.99432 gi|29375009|ref|NP_814162.1| 226185.EF0371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]