SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29375476|ref|NP_814630.1| from Enterococcus faecalis V583

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29375476|ref|NP_814630.1|
Domain Number 1 Region: 3-380
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.66e-103
Family AAT-like 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|29375476|ref|NP_814630.1|
Sequence length 384
Comment aspartate aminotransferase [Enterococcus faecalis V583]
Sequence
MDRKNIATRYQQPTENLLMDIATLAKKTPNLIDLSIGDPDLITDERIIEQAANDAKNGHT
KYTASDGSEAFIEAVIQFYQSHYQLSFQPNQVRATVGALHGMYLALQVILNPGDEVIIHE
PYFSPYKDQVLLADGVPVFLPTYEEDGFQIDVALLKEKITPKTKAIILNSPNNPTGAVFS
EETFREIAQVAIEHNLYILSDEVYEAFCFQETFTPMATFAPENTITFGSFSKAFAMTGWR
IGYMIAPDYINEVAKLINEGVTYSAPTLSQQAGIYALQHFDEFVDPIVEVFQTRLEYVAQ
RVAKIPFLSLHPVKGSIYAFINIQKTGLTSVPFVEKLLKETQVLVIPGKAFGETTGDEYI
RLAATQNLDLLKEAFDRIERMTFE
Download sequence
Identical sequences A0A059MZU9 A0A0E9E0Q1 A0A0M2AUH5 A0A0M2CKL1 A0A0U1AMC1 A0A0Y4I5A0 A0A125W9Y0 A0A1R4IHP6 A0A1X2NPS4 E0HC83 E6GPP6 E6GU20 E6H5V0 E6I8A9 Q837F1 R3H4M3 S4BSZ0 S4FEQ6 S4FLF6 U6S4S3 X5NXW0
NP_814630.1.90627 WP_002355768.1.100343 WP_002355768.1.100390 WP_002355768.1.100415 WP_002355768.1.10042 WP_002355768.1.100482 WP_002355768.1.101272 WP_002355768.1.101275 WP_002355768.1.101808 WP_002355768.1.101818 WP_002355768.1.101914 WP_002355768.1.102128 WP_002355768.1.10696 WP_002355768.1.11048 WP_002355768.1.11193 WP_002355768.1.11459 WP_002355768.1.11776 WP_002355768.1.12145 WP_002355768.1.12247 WP_002355768.1.12630 WP_002355768.1.12889 WP_002355768.1.1291 WP_002355768.1.12926 WP_002355768.1.13365 WP_002355768.1.13369 WP_002355768.1.13739 WP_002355768.1.14157 WP_002355768.1.14180 WP_002355768.1.14269 WP_002355768.1.14402 WP_002355768.1.14420 WP_002355768.1.14485 WP_002355768.1.14750 WP_002355768.1.14792 WP_002355768.1.15224 WP_002355768.1.15286 WP_002355768.1.15458 WP_002355768.1.1595 WP_002355768.1.16241 WP_002355768.1.16763 WP_002355768.1.17164 WP_002355768.1.17287 WP_002355768.1.17682 WP_002355768.1.17799 WP_002355768.1.1799 WP_002355768.1.18048 WP_002355768.1.18259 WP_002355768.1.18260 WP_002355768.1.18416 WP_002355768.1.18475 WP_002355768.1.18524 WP_002355768.1.18709 WP_002355768.1.19031 WP_002355768.1.1948 WP_002355768.1.19675 WP_002355768.1.19734 WP_002355768.1.20029 WP_002355768.1.20659 WP_002355768.1.20674 WP_002355768.1.2171 WP_002355768.1.21993 WP_002355768.1.22059 WP_002355768.1.2207 WP_002355768.1.22780 WP_002355768.1.22796 WP_002355768.1.23017 WP_002355768.1.23054 WP_002355768.1.23319 WP_002355768.1.23569 WP_002355768.1.23904 WP_002355768.1.24064 WP_002355768.1.24526 WP_002355768.1.24581 WP_002355768.1.246 WP_002355768.1.24743 WP_002355768.1.2486 WP_002355768.1.25180 WP_002355768.1.25583 WP_002355768.1.25669 WP_002355768.1.25704 WP_002355768.1.25979 WP_002355768.1.27081 WP_002355768.1.274 WP_002355768.1.2799 WP_002355768.1.2801 WP_002355768.1.28038 WP_002355768.1.28221 WP_002355768.1.28428 WP_002355768.1.28817 WP_002355768.1.28932 WP_002355768.1.3016 WP_002355768.1.30275 WP_002355768.1.31224 WP_002355768.1.31324 WP_002355768.1.31326 WP_002355768.1.31656 WP_002355768.1.31869 WP_002355768.1.32099 WP_002355768.1.321 WP_002355768.1.32385 WP_002355768.1.32914 WP_002355768.1.33306 WP_002355768.1.33460 WP_002355768.1.33513 WP_002355768.1.33574 WP_002355768.1.33581 WP_002355768.1.33685 WP_002355768.1.33798 WP_002355768.1.33851 WP_002355768.1.34192 WP_002355768.1.34766 WP_002355768.1.34947 WP_002355768.1.34999 WP_002355768.1.35283 WP_002355768.1.35810 WP_002355768.1.35823 WP_002355768.1.36198 WP_002355768.1.36880 WP_002355768.1.36900 WP_002355768.1.37031 WP_002355768.1.37181 WP_002355768.1.37810 WP_002355768.1.37850 WP_002355768.1.37885 WP_002355768.1.38725 WP_002355768.1.38784 WP_002355768.1.39119 WP_002355768.1.4014 WP_002355768.1.40357 WP_002355768.1.4071 WP_002355768.1.40757 WP_002355768.1.41792 WP_002355768.1.41867 WP_002355768.1.42239 WP_002355768.1.42353 WP_002355768.1.42483 WP_002355768.1.42904 WP_002355768.1.42908 WP_002355768.1.43540 WP_002355768.1.43903 WP_002355768.1.43994 WP_002355768.1.44185 WP_002355768.1.44242 WP_002355768.1.44501 WP_002355768.1.44537 WP_002355768.1.44626 WP_002355768.1.4487 WP_002355768.1.45269 WP_002355768.1.45484 WP_002355768.1.455 WP_002355768.1.4561 WP_002355768.1.45643 WP_002355768.1.45742 WP_002355768.1.45860 WP_002355768.1.45925 WP_002355768.1.46056 WP_002355768.1.46113 WP_002355768.1.46346 WP_002355768.1.46348 WP_002355768.1.46357 WP_002355768.1.46363 WP_002355768.1.46448 WP_002355768.1.46621 WP_002355768.1.47172 WP_002355768.1.47407 WP_002355768.1.47539 WP_002355768.1.47856 WP_002355768.1.47867 WP_002355768.1.48063 WP_002355768.1.48126 WP_002355768.1.48153 WP_002355768.1.49131 WP_002355768.1.49392 WP_002355768.1.49646 WP_002355768.1.4975 WP_002355768.1.49914 WP_002355768.1.50067 WP_002355768.1.50115 WP_002355768.1.50513 WP_002355768.1.50810 WP_002355768.1.50938 WP_002355768.1.51046 WP_002355768.1.51694 WP_002355768.1.51712 WP_002355768.1.52575 WP_002355768.1.52614 WP_002355768.1.52639 WP_002355768.1.52926 WP_002355768.1.53279 WP_002355768.1.53342 WP_002355768.1.53631 WP_002355768.1.53989 WP_002355768.1.53992 WP_002355768.1.54277 WP_002355768.1.54652 WP_002355768.1.54795 WP_002355768.1.54934 WP_002355768.1.54998 WP_002355768.1.55065 WP_002355768.1.57048 WP_002355768.1.57136 WP_002355768.1.57163 WP_002355768.1.57211 WP_002355768.1.57242 WP_002355768.1.57302 WP_002355768.1.57542 WP_002355768.1.57758 WP_002355768.1.58089 WP_002355768.1.58620 WP_002355768.1.59564 WP_002355768.1.59645 WP_002355768.1.59658 WP_002355768.1.59690 WP_002355768.1.59698 WP_002355768.1.5994 WP_002355768.1.59964 WP_002355768.1.60200 WP_002355768.1.60220 WP_002355768.1.60361 WP_002355768.1.60394 WP_002355768.1.60422 WP_002355768.1.60579 WP_002355768.1.60940 WP_002355768.1.61083 WP_002355768.1.61089 WP_002355768.1.61103 WP_002355768.1.61180 WP_002355768.1.61290 WP_002355768.1.61503 WP_002355768.1.6167 WP_002355768.1.61932 WP_002355768.1.62644 WP_002355768.1.62847 WP_002355768.1.6312 WP_002355768.1.63148 WP_002355768.1.63158 WP_002355768.1.63477 WP_002355768.1.63507 WP_002355768.1.63579 WP_002355768.1.63848 WP_002355768.1.63884 WP_002355768.1.64022 WP_002355768.1.64483 WP_002355768.1.65210 WP_002355768.1.65461 WP_002355768.1.65563 WP_002355768.1.6626 WP_002355768.1.66316 WP_002355768.1.66390 WP_002355768.1.66403 WP_002355768.1.6682 WP_002355768.1.66843 WP_002355768.1.66845 WP_002355768.1.66898 WP_002355768.1.66902 WP_002355768.1.67436 WP_002355768.1.67615 WP_002355768.1.67683 WP_002355768.1.67716 WP_002355768.1.68409 WP_002355768.1.68746 WP_002355768.1.6893 WP_002355768.1.68935 WP_002355768.1.69290 WP_002355768.1.69521 WP_002355768.1.69648 WP_002355768.1.70756 WP_002355768.1.7118 WP_002355768.1.71499 WP_002355768.1.71725 WP_002355768.1.72058 WP_002355768.1.72077 WP_002355768.1.72635 WP_002355768.1.74362 WP_002355768.1.75211 WP_002355768.1.75297 WP_002355768.1.75486 WP_002355768.1.75949 WP_002355768.1.76074 WP_002355768.1.76541 WP_002355768.1.76646 WP_002355768.1.77302 WP_002355768.1.77327 WP_002355768.1.77328 WP_002355768.1.77357 WP_002355768.1.77956 WP_002355768.1.7815 WP_002355768.1.7819 WP_002355768.1.78447 WP_002355768.1.78503 WP_002355768.1.78587 WP_002355768.1.78641 WP_002355768.1.79457 WP_002355768.1.7958 WP_002355768.1.80104 WP_002355768.1.80396 WP_002355768.1.80452 WP_002355768.1.80867 WP_002355768.1.80889 WP_002355768.1.81312 WP_002355768.1.81327 WP_002355768.1.81459 WP_002355768.1.81575 WP_002355768.1.81880 WP_002355768.1.82160 WP_002355768.1.82202 WP_002355768.1.82993 WP_002355768.1.83490 WP_002355768.1.83649 WP_002355768.1.8380 WP_002355768.1.84260 WP_002355768.1.84380 WP_002355768.1.84469 WP_002355768.1.84632 WP_002355768.1.84813 WP_002355768.1.85162 WP_002355768.1.85355 WP_002355768.1.85534 WP_002355768.1.8575 WP_002355768.1.85848 WP_002355768.1.85862 WP_002355768.1.85945 WP_002355768.1.85963 WP_002355768.1.86134 WP_002355768.1.86666 WP_002355768.1.86904 WP_002355768.1.87252 WP_002355768.1.87277 WP_002355768.1.87482 WP_002355768.1.87855 WP_002355768.1.8794 WP_002355768.1.88464 WP_002355768.1.8901 WP_002355768.1.89060 WP_002355768.1.89321 WP_002355768.1.89431 WP_002355768.1.90047 WP_002355768.1.90100 WP_002355768.1.90371 WP_002355768.1.90503 WP_002355768.1.90872 WP_002355768.1.91092 WP_002355768.1.91394 WP_002355768.1.91555 WP_002355768.1.9159 WP_002355768.1.91608 WP_002355768.1.91813 WP_002355768.1.91925 WP_002355768.1.92073 WP_002355768.1.9214 WP_002355768.1.92348 WP_002355768.1.92581 WP_002355768.1.92820 WP_002355768.1.93159 WP_002355768.1.93277 WP_002355768.1.93642 WP_002355768.1.93977 WP_002355768.1.94041 WP_002355768.1.94506 WP_002355768.1.94612 WP_002355768.1.94630 WP_002355768.1.95143 WP_002355768.1.95212 WP_002355768.1.95228 WP_002355768.1.95340 WP_002355768.1.95534 WP_002355768.1.9570 WP_002355768.1.95935 WP_002355768.1.95970 WP_002355768.1.95971 WP_002355768.1.96320 WP_002355768.1.96467 WP_002355768.1.96481 WP_002355768.1.96745 WP_002355768.1.96987 WP_002355768.1.97078 WP_002355768.1.97268 WP_002355768.1.97828 WP_002355768.1.98078 WP_002355768.1.98122 WP_002355768.1.98652 WP_002355768.1.98840 WP_002355768.1.98868 WP_002355768.1.99 WP_002355768.1.9925 WP_002355768.1.99432 WP_002355768.1.99543 WP_002355768.1.99748 226185.EF0891 gi|428766398|ref|YP_007152509.1| gi|384512583|ref|YP_005707676.1| gi|29375476|ref|NP_814630.1| gi|397699282|ref|YP_006537070.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]