SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29375882|ref|NP_815036.1| from Enterococcus faecalis V583

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29375882|ref|NP_815036.1|
Domain Number 1 Region: 6-401
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.77e-91
Family AAT-like 0.000000596
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|29375882|ref|NP_815036.1|
Sequence length 405
Comment aminotransferase AlaT [Enterococcus faecalis V583]
Sequence
MRNFKKSDKLNNVSYDVRGPVLEEAERMQEEGIRILKLNTGNPAPFGFDAPNEIVRDMIV
NVRDSEGYSDSKGIFSARKAIEQYCQLKKFPNVTINDIYTGNGVSELITMCMQGLLNNGD
EVLVPMPDYPLWTASVSLAGGTPVHYICDEQAEWYPDIDDIKSKITSNTKAIVIINPNNP
TGALYPKELLLEIVEVARQNDLIIYSDEIYDRLVMDGLVHVPIATLAPDLFVVTLNGLSK
SHRVAGFRCGWMVLSGDKSRVKGYIEGLNMLASMRLCSNVLSQQIIQTALGGYQSVDGLL
LPGGRIYEQREFIYNAINDIPGLSAVKPKAAFYIFPKIDTAKFDIYDDEKFVLDFLHKHH
ILLVHGGGFNWQQPDHFRIVYLPKMEDLKTTADKMREFLSTYKQK
Download sequence
Identical sequences A0A059N1R4 A0A0U1ADG9 A0A1Y0LZE0 C0X4X4 E6GZ16 E6H1T7 J5E5P4 J5EK44 J5G7A2 J5JC72 J5Z4P4 J6BCD2 J6CHG7 J6DA80 J6DUM9 J6EEZ9 J6F5N4 J6FBJ6 J6LMF1 J6NT21 J6QIQ0 J6RLL2 Q835R1 R3GXS6
NP_815036.1.90627 WP_002382249.1.100343 WP_002382249.1.100482 WP_002382249.1.101272 WP_002382249.1.101818 WP_002382249.1.10330 WP_002382249.1.10696 WP_002382249.1.11193 WP_002382249.1.11651 WP_002382249.1.12926 WP_002382249.1.1344 WP_002382249.1.13739 WP_002382249.1.14157 WP_002382249.1.14180 WP_002382249.1.15543 WP_002382249.1.15705 WP_002382249.1.16241 WP_002382249.1.16763 WP_002382249.1.17287 WP_002382249.1.17799 WP_002382249.1.18048 WP_002382249.1.18260 WP_002382249.1.20659 WP_002382249.1.23054 WP_002382249.1.23569 WP_002382249.1.24064 WP_002382249.1.25180 WP_002382249.1.27216 WP_002382249.1.274 WP_002382249.1.2799 WP_002382249.1.28185 WP_002382249.1.28932 WP_002382249.1.29627 WP_002382249.1.31656 WP_002382249.1.32099 WP_002382249.1.32265 WP_002382249.1.33306 WP_002382249.1.33460 WP_002382249.1.33574 WP_002382249.1.34192 WP_002382249.1.34256 WP_002382249.1.35810 WP_002382249.1.35823 WP_002382249.1.36900 WP_002382249.1.39119 WP_002382249.1.39932 WP_002382249.1.4014 WP_002382249.1.41053 WP_002382249.1.42483 WP_002382249.1.43540 WP_002382249.1.43903 WP_002382249.1.44185 WP_002382249.1.44242 WP_002382249.1.44626 WP_002382249.1.45925 WP_002382249.1.46056 WP_002382249.1.46348 WP_002382249.1.47407 WP_002382249.1.47856 WP_002382249.1.47867 WP_002382249.1.49131 WP_002382249.1.49961 WP_002382249.1.50938 WP_002382249.1.52926 WP_002382249.1.55065 WP_002382249.1.57048 WP_002382249.1.57136 WP_002382249.1.57211 WP_002382249.1.57302 WP_002382249.1.57542 WP_002382249.1.58620 WP_002382249.1.5872 WP_002382249.1.59564 WP_002382249.1.59698 WP_002382249.1.59964 WP_002382249.1.60361 WP_002382249.1.60394 WP_002382249.1.61083 WP_002382249.1.62847 WP_002382249.1.63148 WP_002382249.1.63507 WP_002382249.1.63848 WP_002382249.1.63884 WP_002382249.1.6473 WP_002382249.1.66316 WP_002382249.1.66843 WP_002382249.1.66898 WP_002382249.1.67683 WP_002382249.1.69336 WP_002382249.1.69648 WP_002382249.1.70043 WP_002382249.1.73824 WP_002382249.1.77328 WP_002382249.1.7819 WP_002382249.1.78503 WP_002382249.1.78641 WP_002382249.1.7958 WP_002382249.1.80104 WP_002382249.1.80452 WP_002382249.1.80556 WP_002382249.1.81327 WP_002382249.1.81575 WP_002382249.1.82993 WP_002382249.1.83490 WP_002382249.1.8380 WP_002382249.1.84260 WP_002382249.1.86134 WP_002382249.1.8960 WP_002382249.1.89791 WP_002382249.1.90371 WP_002382249.1.90503 WP_002382249.1.90872 WP_002382249.1.91394 WP_002382249.1.93277 WP_002382249.1.94630 WP_002382249.1.94964 WP_002382249.1.95340 WP_002382249.1.95445 WP_002382249.1.95493 WP_002382249.1.95534 WP_002382249.1.9570 WP_002382249.1.96481 WP_002382249.1.96745 WP_002382249.1.97078 WP_002382249.1.98868 WP_002382249.1.99 WP_002382249.1.99022 WP_002382249.1.9925 WP_002382249.1.99432 gi|29375882|ref|NP_815036.1| 226185.EF1314 APC29043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]