SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29376258|ref|NP_815412.1| from Enterococcus faecalis V583

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29376258|ref|NP_815412.1|
Domain Number 1 Region: 7-385
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.29e-105
Family AAT-like 0.00000248
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|29376258|ref|NP_815412.1|
Sequence length 392
Comment aromatic amino acid aminotransferase [Enterococcus faecalis V583]
Sequence
MDLTNRFNRQVNKIAVSLIRQFDEQVSGIEGILKLTLGEPDFNTPEHVKKAAKEAIDANF
SHYTGMSGLLDVREAAAYFMKEKYHLTYQPATEILVTVGATEAISASLLAILEQGDKVLL
PAPIYPGYEPIITLAGAEPVYLDTRDNDFVLTPEMIEAAMAEHGEQVKAIILNYPSNPTG
VTYNRQELQAIADVLKKYDIFVISDEIYSELTYDESHVSIAEMLRDQTILINGLSKSHAM
TGWRIGFIFAPAILTAEIIKVHQYLVTAAATVSQKAAVRALIEGMHDAEIMKEEYRKRRD
FVYEQMTQLGFEVARPNGAFYIFAKIPTGYEQDSMKFCIDLAQKEAVALIPGISFGPEAE
GYVRISYASDMDKLTTAMERIAHYMATQRVTH
Download sequence
Identical sequences A0A059N4L8 A0A0M2ABD7 A0A0U1ADF4 A0A0Y4C1C8 A0A125W5Z3 A0A1B4XP81 A0A1R4L2Q6 C0X5U3 C7VD26 C7X1I9 D4EQT0 D4ET72 E2YCS3 E2YN32 E2YUA6 E6EYY8 E6GHN5 E6GX55 E6H0Q3 E6IA14 J5BHE3 J5CRL9 J5GAE6 J5HAE6 J6BC64 J6BVV7 J6DX51 J6F9W9 J6FEB9 J6LMG4 J6P0M4 J6PRU7 J6R3N7 Q834E9 R3I6J1 R3JAG5 S4DGV7 S4F456 S4G9Z2 X5NZ68
226185.EF1706 gi|397700015|ref|YP_006537803.1| gi|29376258|ref|NP_815412.1| NP_815412.1.90627 WP_002365726.1.100343 WP_002365726.1.100415 WP_002365726.1.100482 WP_002365726.1.101272 WP_002365726.1.101818 WP_002365726.1.101914 WP_002365726.1.10330 WP_002365726.1.10696 WP_002365726.1.10758 WP_002365726.1.11193 WP_002365726.1.11284 WP_002365726.1.11459 WP_002365726.1.11651 WP_002365726.1.12449 WP_002365726.1.12630 WP_002365726.1.12825 WP_002365726.1.12889 WP_002365726.1.12926 WP_002365726.1.13021 WP_002365726.1.13369 WP_002365726.1.1344 WP_002365726.1.13739 WP_002365726.1.14157 WP_002365726.1.14180 WP_002365726.1.14792 WP_002365726.1.15543 WP_002365726.1.15705 WP_002365726.1.1595 WP_002365726.1.16241 WP_002365726.1.16763 WP_002365726.1.17164 WP_002365726.1.17287 WP_002365726.1.17799 WP_002365726.1.17800 WP_002365726.1.1799 WP_002365726.1.18048 WP_002365726.1.18259 WP_002365726.1.18260 WP_002365726.1.18475 WP_002365726.1.18709 WP_002365726.1.19165 WP_002365726.1.1948 WP_002365726.1.19675 WP_002365726.1.19902 WP_002365726.1.19951 WP_002365726.1.20348 WP_002365726.1.20659 WP_002365726.1.20674 WP_002365726.1.22059 WP_002365726.1.2207 WP_002365726.1.23054 WP_002365726.1.23319 WP_002365726.1.23569 WP_002365726.1.24064 WP_002365726.1.24743 WP_002365726.1.25180 WP_002365726.1.25583 WP_002365726.1.25702 WP_002365726.1.26187 WP_002365726.1.274 WP_002365726.1.2799 WP_002365726.1.28185 WP_002365726.1.28487 WP_002365726.1.28932 WP_002365726.1.28980 WP_002365726.1.29097 WP_002365726.1.3016 WP_002365726.1.30586 WP_002365726.1.30609 WP_002365726.1.31326 WP_002365726.1.31656 WP_002365726.1.32099 WP_002365726.1.32265 WP_002365726.1.32385 WP_002365726.1.32500 WP_002365726.1.33139 WP_002365726.1.33306 WP_002365726.1.33460 WP_002365726.1.33531 WP_002365726.1.33574 WP_002365726.1.33685 WP_002365726.1.33798 WP_002365726.1.34192 WP_002365726.1.34256 WP_002365726.1.34999 WP_002365726.1.35171 WP_002365726.1.35449 WP_002365726.1.35810 WP_002365726.1.35823 WP_002365726.1.36198 WP_002365726.1.36209 WP_002365726.1.3645 WP_002365726.1.36880 WP_002365726.1.36900 WP_002365726.1.37885 WP_002365726.1.39119 WP_002365726.1.39932 WP_002365726.1.4014 WP_002365726.1.40757 WP_002365726.1.41053 WP_002365726.1.42483 WP_002365726.1.42904 WP_002365726.1.43540 WP_002365726.1.43903 WP_002365726.1.44185 WP_002365726.1.44242 WP_002365726.1.44501 WP_002365726.1.44626 WP_002365726.1.45484 WP_002365726.1.45643 WP_002365726.1.45925 WP_002365726.1.46056 WP_002365726.1.46113 WP_002365726.1.46348 WP_002365726.1.46363 WP_002365726.1.46448 WP_002365726.1.47407 WP_002365726.1.47856 WP_002365726.1.47867 WP_002365726.1.48153 WP_002365726.1.49131 WP_002365726.1.49961 WP_002365726.1.50067 WP_002365726.1.50115 WP_002365726.1.50160 WP_002365726.1.50513 WP_002365726.1.50810 WP_002365726.1.50938 WP_002365726.1.51046 WP_002365726.1.5113 WP_002365726.1.51712 WP_002365726.1.52639 WP_002365726.1.52926 WP_002365726.1.54634 WP_002365726.1.54795 WP_002365726.1.55065 WP_002365726.1.56483 WP_002365726.1.56974 WP_002365726.1.57048 WP_002365726.1.57136 WP_002365726.1.57163 WP_002365726.1.57211 WP_002365726.1.57302 WP_002365726.1.57542 WP_002365726.1.57705 WP_002365726.1.57758 WP_002365726.1.58620 WP_002365726.1.5872 WP_002365726.1.58766 WP_002365726.1.59564 WP_002365726.1.59690 WP_002365726.1.59698 WP_002365726.1.5994 WP_002365726.1.59964 WP_002365726.1.60220 WP_002365726.1.60361 WP_002365726.1.60394 WP_002365726.1.60422 WP_002365726.1.60579 WP_002365726.1.60776 WP_002365726.1.61083 WP_002365726.1.61089 WP_002365726.1.61290 WP_002365726.1.62847 WP_002365726.1.63148 WP_002365726.1.63477 WP_002365726.1.63507 WP_002365726.1.63848 WP_002365726.1.63884 WP_002365726.1.64483 WP_002365726.1.6473 WP_002365726.1.65210 WP_002365726.1.6626 WP_002365726.1.66308 WP_002365726.1.66316 WP_002365726.1.66390 WP_002365726.1.6682 WP_002365726.1.66843 WP_002365726.1.66845 WP_002365726.1.66898 WP_002365726.1.67683 WP_002365726.1.68746 WP_002365726.1.68828 WP_002365726.1.6893 WP_002365726.1.69648 WP_002365726.1.70043 WP_002365726.1.70756 WP_002365726.1.71406 WP_002365726.1.71499 WP_002365726.1.71510 WP_002365726.1.71725 WP_002365726.1.72635 WP_002365726.1.72733 WP_002365726.1.73824 WP_002365726.1.75486 WP_002365726.1.75949 WP_002365726.1.76128 WP_002365726.1.77327 WP_002365726.1.77328 WP_002365726.1.77357 WP_002365726.1.7819 WP_002365726.1.78447 WP_002365726.1.78471 WP_002365726.1.78503 WP_002365726.1.78641 WP_002365726.1.7958 WP_002365726.1.79791 WP_002365726.1.80104 WP_002365726.1.80396 WP_002365726.1.80452 WP_002365726.1.80556 WP_002365726.1.80889 WP_002365726.1.80976 WP_002365726.1.81327 WP_002365726.1.81575 WP_002365726.1.8179 WP_002365726.1.82555 WP_002365726.1.82993 WP_002365726.1.83032 WP_002365726.1.83490 WP_002365726.1.8380 WP_002365726.1.84260 WP_002365726.1.84380 WP_002365726.1.84632 WP_002365726.1.85162 WP_002365726.1.85355 WP_002365726.1.85465 WP_002365726.1.85534 WP_002365726.1.86134 WP_002365726.1.86666 WP_002365726.1.87252 WP_002365726.1.87277 WP_002365726.1.8794 WP_002365726.1.89088 WP_002365726.1.8960 WP_002365726.1.89791 WP_002365726.1.90371 WP_002365726.1.90503 WP_002365726.1.90872 WP_002365726.1.91092 WP_002365726.1.91394 WP_002365726.1.91555 WP_002365726.1.92348 WP_002365726.1.93277 WP_002365726.1.93642 WP_002365726.1.93977 WP_002365726.1.94630 WP_002365726.1.94964 WP_002365726.1.95212 WP_002365726.1.95340 WP_002365726.1.95445 WP_002365726.1.95493 WP_002365726.1.95534 WP_002365726.1.95629 WP_002365726.1.9570 WP_002365726.1.95935 WP_002365726.1.96481 WP_002365726.1.96745 WP_002365726.1.96764 WP_002365726.1.97078 WP_002365726.1.98122 WP_002365726.1.9842 WP_002365726.1.98652 WP_002365726.1.98868 WP_002365726.1.99 WP_002365726.1.9925 WP_002365726.1.99432 gi|479180277|ref|YP_007807586.1| gi|384513381|ref|YP_005708474.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]