SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29376581|ref|NP_815735.1| from Enterococcus faecalis V583

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29376581|ref|NP_815735.1|
Domain Number 1 Region: 3-378
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.43e-103
Family Cystathionine synthase-like 0.00000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|29376581|ref|NP_815735.1|
Sequence length 381
Comment class V aminotransferase [Enterococcus faecalis V583]
Sequence
MEPIYLDHAATTPLHPTVIQAMTENMQTTFGNPSSIHQFGRKAHGLLEEVRQTIAESLQA
KPHEIIFNSGGTEGDNTAILAVAFSRQKEGKHIITTAIEHPAVLRTMEYLETLGFEVTYL
PVNENGQISMDQFKKSLREETILVSMMYGNNEIGNRLPIAEVGAILKNHSAIFHTDAVQA
YGSEVILPHELGIDLLSISAHKINGPKGVGFLFKSDAIQLPPLLHGGEQEEKRRAGTENL
AGIIGMGTAVSLLTSAEKQARKTAYQSFQTIILKALEEANIDFSINGEPTNRLAHVLNLH
LKGIPSDLLLMHLDLRGIAISTGSACTAGTVDPSHVLTAMYGENSSAIKESIRISFGYGN
TPEEIATFSEVLVAVIQQLKK
Download sequence
Identical sequences A0A059MYL4 A0A0H1UBT1 A0A0M2CP41 A0A0U1ANR6 A0A1B4XPY7 C0X9I8 C7D2E6 C7X0P3 D4ELS1 D4EZK5 E2YDS0 E2YQ25 E6GRV9 E6H2Z1 J5ASF1 J5CHG2 J5EYH3 J5F518 J5IV79 J6AWX1 J6BQ54 J6EN75 J6ET86 J6EZJ5 J6HAU6 J6NRT2 J6P8B3 J6PYT9 J6Q338 J6QIR5 Q832Z6 R3KWP4 S4EEY4 S4FTK2
gi|29376581|ref|NP_815735.1| 226185.EF2072 NP_815735.1.90627 WP_002360007.1.100343 WP_002360007.1.100482 WP_002360007.1.101272 WP_002360007.1.101808 WP_002360007.1.101818 WP_002360007.1.101914 WP_002360007.1.10696 WP_002360007.1.10758 WP_002360007.1.11193 WP_002360007.1.11651 WP_002360007.1.12145 WP_002360007.1.12825 WP_002360007.1.12889 WP_002360007.1.12926 WP_002360007.1.13021 WP_002360007.1.13369 WP_002360007.1.1344 WP_002360007.1.13739 WP_002360007.1.14157 WP_002360007.1.14180 WP_002360007.1.14750 WP_002360007.1.15543 WP_002360007.1.15705 WP_002360007.1.16241 WP_002360007.1.16763 WP_002360007.1.17287 WP_002360007.1.17799 WP_002360007.1.17800 WP_002360007.1.18048 WP_002360007.1.18260 WP_002360007.1.19165 WP_002360007.1.19902 WP_002360007.1.19951 WP_002360007.1.20659 WP_002360007.1.23054 WP_002360007.1.23322 WP_002360007.1.23498 WP_002360007.1.23569 WP_002360007.1.24059 WP_002360007.1.24064 WP_002360007.1.24581 WP_002360007.1.24743 WP_002360007.1.25180 WP_002360007.1.25704 WP_002360007.1.26187 WP_002360007.1.27216 WP_002360007.1.274 WP_002360007.1.2799 WP_002360007.1.28185 WP_002360007.1.28932 WP_002360007.1.29627 WP_002360007.1.30586 WP_002360007.1.31656 WP_002360007.1.32099 WP_002360007.1.321 WP_002360007.1.32265 WP_002360007.1.32385 WP_002360007.1.32500 WP_002360007.1.33306 WP_002360007.1.33460 WP_002360007.1.33513 WP_002360007.1.33531 WP_002360007.1.33574 WP_002360007.1.33581 WP_002360007.1.34192 WP_002360007.1.34256 WP_002360007.1.34999 WP_002360007.1.35449 WP_002360007.1.35810 WP_002360007.1.35823 WP_002360007.1.36209 WP_002360007.1.36900 WP_002360007.1.37996 WP_002360007.1.39119 WP_002360007.1.39771 WP_002360007.1.39932 WP_002360007.1.4014 WP_002360007.1.40357 WP_002360007.1.41053 WP_002360007.1.41867 WP_002360007.1.42239 WP_002360007.1.42353 WP_002360007.1.42483 WP_002360007.1.43903 WP_002360007.1.44185 WP_002360007.1.44242 WP_002360007.1.44537 WP_002360007.1.44626 WP_002360007.1.45269 WP_002360007.1.45484 WP_002360007.1.45742 WP_002360007.1.45925 WP_002360007.1.46056 WP_002360007.1.46348 WP_002360007.1.46621 WP_002360007.1.47407 WP_002360007.1.47856 WP_002360007.1.47867 WP_002360007.1.48676 WP_002360007.1.49131 WP_002360007.1.49646 WP_002360007.1.49961 WP_002360007.1.50067 WP_002360007.1.50160 WP_002360007.1.50938 WP_002360007.1.5113 WP_002360007.1.52926 WP_002360007.1.54634 WP_002360007.1.55065 WP_002360007.1.57048 WP_002360007.1.57136 WP_002360007.1.57211 WP_002360007.1.57542 WP_002360007.1.57705 WP_002360007.1.58620 WP_002360007.1.5872 WP_002360007.1.59564 WP_002360007.1.59698 WP_002360007.1.5994 WP_002360007.1.59964 WP_002360007.1.60361 WP_002360007.1.60394 WP_002360007.1.60776 WP_002360007.1.60940 WP_002360007.1.61083 WP_002360007.1.61089 WP_002360007.1.61290 WP_002360007.1.62847 WP_002360007.1.63148 WP_002360007.1.63507 WP_002360007.1.63579 WP_002360007.1.63848 WP_002360007.1.63884 WP_002360007.1.65397 WP_002360007.1.65563 WP_002360007.1.6626 WP_002360007.1.66308 WP_002360007.1.66316 WP_002360007.1.66767 WP_002360007.1.66843 WP_002360007.1.66898 WP_002360007.1.67683 WP_002360007.1.68746 WP_002360007.1.69648 WP_002360007.1.70675 WP_002360007.1.70756 WP_002360007.1.71499 WP_002360007.1.73695 WP_002360007.1.73824 WP_002360007.1.75486 WP_002360007.1.76128 WP_002360007.1.76541 WP_002360007.1.76958 WP_002360007.1.77328 WP_002360007.1.7819 WP_002360007.1.78503 WP_002360007.1.78641 WP_002360007.1.7958 WP_002360007.1.79975 WP_002360007.1.80104 WP_002360007.1.80452 WP_002360007.1.80556 WP_002360007.1.8058 WP_002360007.1.80889 WP_002360007.1.81312 WP_002360007.1.81327 WP_002360007.1.81575 WP_002360007.1.8179 WP_002360007.1.82202 WP_002360007.1.82555 WP_002360007.1.82993 WP_002360007.1.83327 WP_002360007.1.83490 WP_002360007.1.8380 WP_002360007.1.84260 WP_002360007.1.84573 WP_002360007.1.84632 WP_002360007.1.84813 WP_002360007.1.85355 WP_002360007.1.85465 WP_002360007.1.85945 WP_002360007.1.86134 WP_002360007.1.86904 WP_002360007.1.87000 WP_002360007.1.87277 WP_002360007.1.8794 WP_002360007.1.89791 WP_002360007.1.90100 WP_002360007.1.90371 WP_002360007.1.90503 WP_002360007.1.90872 WP_002360007.1.91394 WP_002360007.1.91813 WP_002360007.1.91925 WP_002360007.1.92348 WP_002360007.1.92581 WP_002360007.1.93277 WP_002360007.1.94399 WP_002360007.1.94630 WP_002360007.1.94964 WP_002360007.1.95228 WP_002360007.1.95340 WP_002360007.1.95445 WP_002360007.1.95493 WP_002360007.1.95534 WP_002360007.1.9570 WP_002360007.1.96481 WP_002360007.1.96745 WP_002360007.1.96987 WP_002360007.1.97078 WP_002360007.1.98868 WP_002360007.1.99 WP_002360007.1.99022 WP_002360007.1.9925 WP_002360007.1.99432 gi|384513639|ref|YP_005708732.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]