SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29376870|ref|NP_816024.1| from Enterococcus faecalis V583

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29376870|ref|NP_816024.1|
Domain Number 1 Region: 1-392
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.92e-110
Family AAT-like 0.000000716
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|29376870|ref|NP_816024.1|
Sequence length 399
Comment aspartate aminotransferase [Enterococcus faecalis V583]
Sequence
MNVSNRAQQLTPSVTLAAAAKAKALKAKGVDVLSLTVGEPDFVTPKNIQKAAIASIEDGR
ASYYTPSGGIPELKQAIVSYVEREYQLRYQPKQVIVTDGAKYALYLLFQAILNVGDEVII
PVPYWVSYGEQVKLAEGKPVFVSSTQEQSFKVSVAQLEAVRTDKTKAIILNSPSNPTGVI
YTEEELRQIGEWAVAHNILIIADDIYGRLVYNGHRFTPIATISEAIRQQTIIINGVSKTY
AMTGWRIGFAVGDEKIIQAMTQLASQSTSNPVAVSQYAAIEALTGEQSTVEDMRQAFEKR
LNHIYPKVAALPGVSLIKPEGAFYLFPNVKKTLEICGYDNVTNWVEDLLQEAHVALVTGE
GFGAPEHVRMSYATDLMTLEKAIERMNDFIEKKRIQHNA
Download sequence
Identical sequences A0A059MYT0 A0A0H1TUJ0 A0A0M2CJK4 A0A0U1AVQ5 A0A111T1P5 A0A125W2R0 A0A1J6XGP9 A0A1R4IS21 C0X8Q1 C7D1S0 E6GYE3 E6H5D3 E6IC16 J5B4T9 J5CZS1 J5D5Z9 J5D9N2 J5DY38 J5HI28 J5HJG2 J5IZH1 J6DV75 J6EIQ0 J6EJ71 J6ENS9 J6MQB7 J6PL62 J6R0A7 J6RIH3 Q831X3 U6S023 V7ZSQ8
NP_816024.1.90627 WP_002359774.1.100343 WP_002359774.1.100390 WP_002359774.1.100415 WP_002359774.1.100482 WP_002359774.1.101272 WP_002359774.1.101275 WP_002359774.1.101808 WP_002359774.1.101818 WP_002359774.1.101914 WP_002359774.1.10696 WP_002359774.1.11193 WP_002359774.1.11459 WP_002359774.1.11651 WP_002359774.1.12145 WP_002359774.1.12825 WP_002359774.1.12926 WP_002359774.1.13365 WP_002359774.1.1344 WP_002359774.1.13739 WP_002359774.1.14157 WP_002359774.1.14180 WP_002359774.1.14269 WP_002359774.1.14402 WP_002359774.1.14420 WP_002359774.1.14792 WP_002359774.1.15543 WP_002359774.1.15705 WP_002359774.1.1595 WP_002359774.1.16241 WP_002359774.1.16763 WP_002359774.1.17164 WP_002359774.1.17287 WP_002359774.1.17799 WP_002359774.1.1799 WP_002359774.1.18048 WP_002359774.1.18259 WP_002359774.1.18260 WP_002359774.1.18416 WP_002359774.1.18475 WP_002359774.1.18709 WP_002359774.1.19031 WP_002359774.1.1948 WP_002359774.1.19601 WP_002359774.1.20659 WP_002359774.1.2067 WP_002359774.1.20674 WP_002359774.1.22059 WP_002359774.1.2207 WP_002359774.1.23017 WP_002359774.1.23054 WP_002359774.1.23319 WP_002359774.1.23322 WP_002359774.1.23498 WP_002359774.1.23569 WP_002359774.1.24059 WP_002359774.1.24064 WP_002359774.1.24581 WP_002359774.1.24743 WP_002359774.1.25180 WP_002359774.1.25583 WP_002359774.1.25669 WP_002359774.1.27216 WP_002359774.1.274 WP_002359774.1.2799 WP_002359774.1.2801 WP_002359774.1.28185 WP_002359774.1.28932 WP_002359774.1.29627 WP_002359774.1.3016 WP_002359774.1.31324 WP_002359774.1.31326 WP_002359774.1.31656 WP_002359774.1.32099 WP_002359774.1.32265 WP_002359774.1.32914 WP_002359774.1.33306 WP_002359774.1.33460 WP_002359774.1.33574 WP_002359774.1.33798 WP_002359774.1.34256 WP_002359774.1.34947 WP_002359774.1.34999 WP_002359774.1.35810 WP_002359774.1.35823 WP_002359774.1.36198 WP_002359774.1.36900 WP_002359774.1.37181 WP_002359774.1.37885 WP_002359774.1.38725 WP_002359774.1.38784 WP_002359774.1.3909 WP_002359774.1.39119 WP_002359774.1.39932 WP_002359774.1.4014 WP_002359774.1.40357 WP_002359774.1.40757 WP_002359774.1.41053 WP_002359774.1.41867 WP_002359774.1.42239 WP_002359774.1.42483 WP_002359774.1.43903 WP_002359774.1.44185 WP_002359774.1.44242 WP_002359774.1.44501 WP_002359774.1.44626 WP_002359774.1.4561 WP_002359774.1.45860 WP_002359774.1.45925 WP_002359774.1.46056 WP_002359774.1.46348 WP_002359774.1.46357 WP_002359774.1.46363 WP_002359774.1.46448 WP_002359774.1.46606 WP_002359774.1.47172 WP_002359774.1.47407 WP_002359774.1.47539 WP_002359774.1.47856 WP_002359774.1.47867 WP_002359774.1.48063 WP_002359774.1.48153 WP_002359774.1.49131 WP_002359774.1.49392 WP_002359774.1.49914 WP_002359774.1.49961 WP_002359774.1.50513 WP_002359774.1.50938 WP_002359774.1.51046 WP_002359774.1.51712 WP_002359774.1.52575 WP_002359774.1.52926 WP_002359774.1.53342 WP_002359774.1.53992 WP_002359774.1.54652 WP_002359774.1.54795 WP_002359774.1.54934 WP_002359774.1.55065 WP_002359774.1.57048 WP_002359774.1.57136 WP_002359774.1.57163 WP_002359774.1.57211 WP_002359774.1.57242 WP_002359774.1.57542 WP_002359774.1.58620 WP_002359774.1.5872 WP_002359774.1.59690 WP_002359774.1.59698 WP_002359774.1.59964 WP_002359774.1.60200 WP_002359774.1.60220 WP_002359774.1.60361 WP_002359774.1.60394 WP_002359774.1.60579 WP_002359774.1.60940 WP_002359774.1.61083 WP_002359774.1.61089 WP_002359774.1.61503 WP_002359774.1.62847 WP_002359774.1.6312 WP_002359774.1.63148 WP_002359774.1.63477 WP_002359774.1.63507 WP_002359774.1.63579 WP_002359774.1.63848 WP_002359774.1.63884 WP_002359774.1.64483 WP_002359774.1.6473 WP_002359774.1.65210 WP_002359774.1.65563 WP_002359774.1.6626 WP_002359774.1.66316 WP_002359774.1.66390 WP_002359774.1.66767 WP_002359774.1.6682 WP_002359774.1.66843 WP_002359774.1.66845 WP_002359774.1.66898 WP_002359774.1.66902 WP_002359774.1.68828 WP_002359774.1.6893 WP_002359774.1.69648 WP_002359774.1.70675 WP_002359774.1.70799 WP_002359774.1.71303 WP_002359774.1.71499 WP_002359774.1.71725 WP_002359774.1.72635 WP_002359774.1.73824 WP_002359774.1.75297 WP_002359774.1.75949 WP_002359774.1.76541 WP_002359774.1.76958 WP_002359774.1.77302 WP_002359774.1.77327 WP_002359774.1.77328 WP_002359774.1.77357 WP_002359774.1.7819 WP_002359774.1.78447 WP_002359774.1.78503 WP_002359774.1.78641 WP_002359774.1.7958 WP_002359774.1.79975 WP_002359774.1.80104 WP_002359774.1.80452 WP_002359774.1.80556 WP_002359774.1.81327 WP_002359774.1.81459 WP_002359774.1.81575 WP_002359774.1.82555 WP_002359774.1.82993 WP_002359774.1.83327 WP_002359774.1.83490 WP_002359774.1.8380 WP_002359774.1.83953 WP_002359774.1.84260 WP_002359774.1.84380 WP_002359774.1.84469 WP_002359774.1.85162 WP_002359774.1.85534 WP_002359774.1.8575 WP_002359774.1.85945 WP_002359774.1.86134 WP_002359774.1.87000 WP_002359774.1.87277 WP_002359774.1.87855 WP_002359774.1.8794 WP_002359774.1.88329 WP_002359774.1.88464 WP_002359774.1.8901 WP_002359774.1.89791 WP_002359774.1.90100 WP_002359774.1.90371 WP_002359774.1.90503 WP_002359774.1.90642 WP_002359774.1.90872 WP_002359774.1.91092 WP_002359774.1.91394 WP_002359774.1.91555 WP_002359774.1.91813 WP_002359774.1.93159 WP_002359774.1.93277 WP_002359774.1.93642 WP_002359774.1.93977 WP_002359774.1.94041 WP_002359774.1.94399 WP_002359774.1.94964 WP_002359774.1.95212 WP_002359774.1.95340 WP_002359774.1.95445 WP_002359774.1.95493 WP_002359774.1.95534 WP_002359774.1.95629 WP_002359774.1.9570 WP_002359774.1.95935 WP_002359774.1.96481 WP_002359774.1.96745 WP_002359774.1.97078 WP_002359774.1.97268 WP_002359774.1.98122 WP_002359774.1.98652 WP_002359774.1.98868 WP_002359774.1.99 WP_002359774.1.99022 WP_002359774.1.9925 WP_002359774.1.99432 WP_002359774.1.99543 226185.EF2372 gi|29376870|ref|NP_816024.1| gi|384513770|ref|YP_005708863.1| gi|397700567|ref|YP_006538355.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]