SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29377039|ref|NP_816193.1| from Enterococcus faecalis V583

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29377039|ref|NP_816193.1|
Domain Number 1 Region: 4-411
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.7e-177
Family GABA-aminotransferase-like 0.000000000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|29377039|ref|NP_816193.1|
Sequence length 412
Comment serine hydroxymethyltransferase [Enterococcus faecalis V583]
Sequence
MDYKTYDPDLWNAIAREEERQENNLELIASENVVSKAVMAAQGSILTNKYAEGYPGKRYY
GGCEFIDIVENLAIDRAKELFGAKFANVQAHSGSQANTAAYLSLVEPGDTILGMDLSAGG
HLTHGSPVNFSGKTYNFVSYGVDPSTEVIDYDVVRILAREHRPKLIVAGASAYSRTIDFK
RFREIADEVDAKLMVDMAHIAGLVASGLHPNPVPYADIVTSTTHKTLRGPRGGLILTNSE
ELAKKVNSSIFPGIQGGPLEHVIAGKAAAFKEALDPSFAEYSQQVIANAQAMTKVFNQAP
EARLISGATDNHLLLIEVTGFGLNGKEAEAILDSVNITVNKNSIPFEQLSPFKTSGIRIG
TPAITSRGFKEEDAVEVAKLIVQVLKDPENTAVHDEVKAAVAALTKKYPLYN
Download sequence
Identical sequences A0A059MZR3 A0A0E9EDX3 A0A0H1TQH1 A0A0M2A9F1 A0A0M2AQ33 A0A0M2CJ27 A0A0U1B2F6 A0A0Y4CQR4 A0A0Y7HP85 A0A125W2Z2 A0A1B4XQP4 A0A1R4KSR4 C0X8B1 C7D1D8 C7VAT7 C7WZV3 D4EIF5 D4EWU8 E0HAY2 E2YF28 E2YP49 E2Z014 E6EV03 E6GKC9 E6GW82 E6H4B7 E6IBP8 J6B4M5 J6BM40 J6CBJ1 J6CF21 J6CZ30 J6DLN3 J6DMA9 J6FCU2 J6FEL7 J6M8D2 J6NLV7 J6QEU6 J6QIB7 J6QWM9 J6QY70 J6RGR8 Q831F9 R3KS66 S4CDP1 S4FAN0 S4FHC8 U6S421 V7ZS96
gi|428767711|ref|YP_007153822.1| NP_816193.1.90627 WP_002356623.1.100343 WP_002356623.1.100390 WP_002356623.1.100415 WP_002356623.1.10042 WP_002356623.1.100482 WP_002356623.1.101272 WP_002356623.1.101275 WP_002356623.1.101479 WP_002356623.1.101808 WP_002356623.1.101818 WP_002356623.1.101914 WP_002356623.1.102128 WP_002356623.1.10330 WP_002356623.1.10696 WP_002356623.1.10758 WP_002356623.1.11048 WP_002356623.1.11193 WP_002356623.1.11284 WP_002356623.1.11459 WP_002356623.1.11651 WP_002356623.1.11776 WP_002356623.1.12145 WP_002356623.1.12235 WP_002356623.1.12449 WP_002356623.1.12625 WP_002356623.1.12630 WP_002356623.1.12825 WP_002356623.1.12889 WP_002356623.1.1291 WP_002356623.1.12926 WP_002356623.1.13021 WP_002356623.1.13365 WP_002356623.1.13369 WP_002356623.1.1344 WP_002356623.1.13739 WP_002356623.1.14157 WP_002356623.1.14180 WP_002356623.1.14269 WP_002356623.1.14402 WP_002356623.1.14420 WP_002356623.1.14485 WP_002356623.1.14750 WP_002356623.1.14792 WP_002356623.1.15224 WP_002356623.1.15286 WP_002356623.1.15458 WP_002356623.1.15543 WP_002356623.1.15705 WP_002356623.1.1595 WP_002356623.1.16241 WP_002356623.1.16763 WP_002356623.1.17164 WP_002356623.1.17287 WP_002356623.1.17682 WP_002356623.1.17799 WP_002356623.1.17800 WP_002356623.1.1799 WP_002356623.1.18048 WP_002356623.1.18259 WP_002356623.1.18260 WP_002356623.1.18390 WP_002356623.1.18416 WP_002356623.1.18475 WP_002356623.1.18524 WP_002356623.1.18709 WP_002356623.1.19031 WP_002356623.1.19115 WP_002356623.1.19165 WP_002356623.1.1948 WP_002356623.1.19601 WP_002356623.1.19675 WP_002356623.1.19734 WP_002356623.1.19902 WP_002356623.1.19951 WP_002356623.1.20029 WP_002356623.1.20348 WP_002356623.1.20659 WP_002356623.1.2067 WP_002356623.1.20674 WP_002356623.1.2171 WP_002356623.1.21993 WP_002356623.1.22059 WP_002356623.1.2207 WP_002356623.1.22780 WP_002356623.1.22796 WP_002356623.1.23017 WP_002356623.1.23054 WP_002356623.1.23319 WP_002356623.1.23322 WP_002356623.1.23498 WP_002356623.1.23569 WP_002356623.1.23904 WP_002356623.1.24023 WP_002356623.1.24059 WP_002356623.1.24064 WP_002356623.1.24526 WP_002356623.1.24581 WP_002356623.1.246 WP_002356623.1.24743 WP_002356623.1.2486 WP_002356623.1.25180 WP_002356623.1.25583 WP_002356623.1.25669 WP_002356623.1.25702 WP_002356623.1.25704 WP_002356623.1.25979 WP_002356623.1.26187 WP_002356623.1.26451 WP_002356623.1.27081 WP_002356623.1.27216 WP_002356623.1.274 WP_002356623.1.2799 WP_002356623.1.2801 WP_002356623.1.28038 WP_002356623.1.28185 WP_002356623.1.28221 WP_002356623.1.28428 WP_002356623.1.28487 WP_002356623.1.28579 WP_002356623.1.28817 WP_002356623.1.28932 WP_002356623.1.28980 WP_002356623.1.29097 WP_002356623.1.29627 WP_002356623.1.29985 WP_002356623.1.3016 WP_002356623.1.30275 WP_002356623.1.30586 WP_002356623.1.30609 WP_002356623.1.31324 WP_002356623.1.31326 WP_002356623.1.31656 WP_002356623.1.32099 WP_002356623.1.32265 WP_002356623.1.32385 WP_002356623.1.32500 WP_002356623.1.32914 WP_002356623.1.33139 WP_002356623.1.33306 WP_002356623.1.33460 WP_002356623.1.33574 WP_002356623.1.33685 WP_002356623.1.33798 WP_002356623.1.33851 WP_002356623.1.34192 WP_002356623.1.34256 WP_002356623.1.34766 WP_002356623.1.34947 WP_002356623.1.34999 WP_002356623.1.35171 WP_002356623.1.35283 WP_002356623.1.35449 WP_002356623.1.35810 WP_002356623.1.35823 WP_002356623.1.36198 WP_002356623.1.36209 WP_002356623.1.36269 WP_002356623.1.3645 WP_002356623.1.36880 WP_002356623.1.36900 WP_002356623.1.37181 WP_002356623.1.37810 WP_002356623.1.37850 WP_002356623.1.37996 WP_002356623.1.38784 WP_002356623.1.3909 WP_002356623.1.39119 WP_002356623.1.39771 WP_002356623.1.39932 WP_002356623.1.4014 WP_002356623.1.40357 WP_002356623.1.4071 WP_002356623.1.40757 WP_002356623.1.40908 WP_002356623.1.41053 WP_002356623.1.41792 WP_002356623.1.41867 WP_002356623.1.42239 WP_002356623.1.42483 WP_002356623.1.42904 WP_002356623.1.42908 WP_002356623.1.43540 WP_002356623.1.43903 WP_002356623.1.43994 WP_002356623.1.44185 WP_002356623.1.44242 WP_002356623.1.44501 WP_002356623.1.44626 WP_002356623.1.4487 WP_002356623.1.45269 WP_002356623.1.45484 WP_002356623.1.455 WP_002356623.1.4561 WP_002356623.1.45643 WP_002356623.1.45860 WP_002356623.1.45925 WP_002356623.1.46056 WP_002356623.1.46113 WP_002356623.1.46346 WP_002356623.1.46348 WP_002356623.1.46357 WP_002356623.1.46363 WP_002356623.1.46448 WP_002356623.1.46606 WP_002356623.1.47172 WP_002356623.1.47217 WP_002356623.1.47225 WP_002356623.1.47407 WP_002356623.1.47539 WP_002356623.1.47856 WP_002356623.1.47867 WP_002356623.1.48063 WP_002356623.1.48126 WP_002356623.1.48153 WP_002356623.1.48676 WP_002356623.1.49131 WP_002356623.1.49392 WP_002356623.1.49646 WP_002356623.1.4975 WP_002356623.1.49914 WP_002356623.1.49961 WP_002356623.1.50067 WP_002356623.1.50115 WP_002356623.1.50160 WP_002356623.1.50513 WP_002356623.1.50810 WP_002356623.1.5083 WP_002356623.1.50938 WP_002356623.1.51046 WP_002356623.1.5113 WP_002356623.1.51694 WP_002356623.1.52575 WP_002356623.1.52614 WP_002356623.1.52639 WP_002356623.1.52926 WP_002356623.1.53279 WP_002356623.1.53342 WP_002356623.1.53989 WP_002356623.1.53992 WP_002356623.1.54277 WP_002356623.1.54652 WP_002356623.1.54795 WP_002356623.1.54934 WP_002356623.1.54998 WP_002356623.1.55065 WP_002356623.1.56483 WP_002356623.1.5680 WP_002356623.1.56974 WP_002356623.1.57048 WP_002356623.1.57136 WP_002356623.1.57163 WP_002356623.1.57211 WP_002356623.1.57242 WP_002356623.1.57542 WP_002356623.1.57671 WP_002356623.1.57705 WP_002356623.1.57758 WP_002356623.1.57968 WP_002356623.1.58089 WP_002356623.1.58620 WP_002356623.1.5872 WP_002356623.1.58766 WP_002356623.1.59454 WP_002356623.1.59564 WP_002356623.1.59645 WP_002356623.1.59658 WP_002356623.1.59690 WP_002356623.1.59698 WP_002356623.1.5994 WP_002356623.1.59964 WP_002356623.1.60200 WP_002356623.1.60220 WP_002356623.1.60361 WP_002356623.1.60394 WP_002356623.1.60422 WP_002356623.1.60579 WP_002356623.1.60776 WP_002356623.1.60940 WP_002356623.1.61083 WP_002356623.1.61089 WP_002356623.1.61103 WP_002356623.1.61180 WP_002356623.1.61503 WP_002356623.1.61932 WP_002356623.1.62847 WP_002356623.1.62949 WP_002356623.1.6312 WP_002356623.1.63148 WP_002356623.1.63158 WP_002356623.1.63477 WP_002356623.1.63507 WP_002356623.1.63579 WP_002356623.1.63848 WP_002356623.1.63884 WP_002356623.1.64022 WP_002356623.1.64483 WP_002356623.1.6473 WP_002356623.1.65210 WP_002356623.1.65397 WP_002356623.1.65461 WP_002356623.1.65563 WP_002356623.1.6626 WP_002356623.1.66308 WP_002356623.1.66316 WP_002356623.1.66390 WP_002356623.1.66403 WP_002356623.1.66767 WP_002356623.1.6682 WP_002356623.1.66843 WP_002356623.1.66845 WP_002356623.1.66898 WP_002356623.1.66902 WP_002356623.1.67436 WP_002356623.1.67615 WP_002356623.1.67683 WP_002356623.1.67716 WP_002356623.1.68409 WP_002356623.1.68746 WP_002356623.1.68828 WP_002356623.1.6893 WP_002356623.1.68935 WP_002356623.1.69290 WP_002356623.1.69336 WP_002356623.1.69521 WP_002356623.1.69648 WP_002356623.1.69824 WP_002356623.1.70043 WP_002356623.1.70675 WP_002356623.1.70799 WP_002356623.1.71303 WP_002356623.1.71406 WP_002356623.1.71510 WP_002356623.1.71725 WP_002356623.1.72058 WP_002356623.1.72077 WP_002356623.1.72635 WP_002356623.1.73695 WP_002356623.1.73824 WP_002356623.1.74362 WP_002356623.1.74389 WP_002356623.1.75297 WP_002356623.1.75486 WP_002356623.1.75949 WP_002356623.1.76074 WP_002356623.1.76128 WP_002356623.1.76541 WP_002356623.1.76646 WP_002356623.1.76958 WP_002356623.1.77302 WP_002356623.1.77327 WP_002356623.1.77328 WP_002356623.1.77357 WP_002356623.1.77956 WP_002356623.1.7815 WP_002356623.1.7819 WP_002356623.1.78447 WP_002356623.1.78471 WP_002356623.1.78503 WP_002356623.1.78641 WP_002356623.1.79457 WP_002356623.1.7958 WP_002356623.1.79791 WP_002356623.1.79975 WP_002356623.1.80104 WP_002356623.1.80396 WP_002356623.1.80452 WP_002356623.1.80556 WP_002356623.1.8058 WP_002356623.1.80867 WP_002356623.1.80889 WP_002356623.1.80976 WP_002356623.1.81327 WP_002356623.1.81459 WP_002356623.1.81575 WP_002356623.1.8179 WP_002356623.1.81880 WP_002356623.1.81991 WP_002356623.1.82160 WP_002356623.1.82555 WP_002356623.1.82993 WP_002356623.1.83327 WP_002356623.1.83490 WP_002356623.1.83649 WP_002356623.1.8380 WP_002356623.1.83953 WP_002356623.1.84260 WP_002356623.1.84380 WP_002356623.1.84469 WP_002356623.1.84632 WP_002356623.1.85162 WP_002356623.1.85465 WP_002356623.1.85534 WP_002356623.1.8575 WP_002356623.1.85862 WP_002356623.1.85945 WP_002356623.1.85963 WP_002356623.1.86134 WP_002356623.1.87000 WP_002356623.1.87252 WP_002356623.1.87277 WP_002356623.1.87385 WP_002356623.1.87482 WP_002356623.1.87855 WP_002356623.1.88329 WP_002356623.1.88464 WP_002356623.1.88661 WP_002356623.1.8901 WP_002356623.1.89060 WP_002356623.1.89088 WP_002356623.1.89321 WP_002356623.1.89431 WP_002356623.1.8960 WP_002356623.1.89791 WP_002356623.1.90100 WP_002356623.1.90371 WP_002356623.1.90503 WP_002356623.1.90872 WP_002356623.1.91092 WP_002356623.1.91394 WP_002356623.1.91555 WP_002356623.1.9159 WP_002356623.1.91608 WP_002356623.1.91813 WP_002356623.1.92037 WP_002356623.1.92073 WP_002356623.1.9214 WP_002356623.1.92581 WP_002356623.1.92820 WP_002356623.1.93159 WP_002356623.1.93277 WP_002356623.1.93642 WP_002356623.1.93977 WP_002356623.1.94041 WP_002356623.1.94399 WP_002356623.1.94506 WP_002356623.1.94630 WP_002356623.1.94964 WP_002356623.1.95143 WP_002356623.1.95212 WP_002356623.1.95228 WP_002356623.1.95340 WP_002356623.1.95445 WP_002356623.1.95493 WP_002356623.1.95534 WP_002356623.1.95629 WP_002356623.1.9570 WP_002356623.1.95935 WP_002356623.1.95970 WP_002356623.1.95971 WP_002356623.1.96320 WP_002356623.1.96467 WP_002356623.1.96481 WP_002356623.1.96745 WP_002356623.1.96764 WP_002356623.1.97078 WP_002356623.1.97268 WP_002356623.1.97643 WP_002356623.1.97828 WP_002356623.1.98078 WP_002356623.1.98122 WP_002356623.1.9842 WP_002356623.1.98652 WP_002356623.1.98840 WP_002356623.1.98868 WP_002356623.1.99 WP_002356623.1.99014 WP_002356623.1.99022 WP_002356623.1.9925 WP_002356623.1.99432 WP_002356623.1.99543 WP_002356623.1.99748 226185.EF2550 gi|479180732|ref|YP_007808041.1| gi|29377039|ref|NP_816193.1| gi|397700691|ref|YP_006538479.1| gi|384519358|ref|YP_005706663.1| gi|384513896|ref|YP_005708989.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]