SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29377360|ref|NP_816514.1| from Enterococcus faecalis V583

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29377360|ref|NP_816514.1|
Domain Number 1 Region: 1-387
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.29e-93
Family Cystathionine synthase-like 0.0000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|29377360|ref|NP_816514.1|
Sequence length 388
Comment class II aminotransferase [Enterococcus faecalis V583]
Sequence
MFNFNETIERRHTNCVKWDTVEASYHEKDLLPLWVADMDFKVHQPILDALSQVIEQGILG
YAVAPNELYQAIQDWQRQHHQLIVEKEEILFNSGVVPSLATTVQAYTAPADSVMICDPVY
PPFADVVKQNERRLVRHSLLEVNGHYEVDLVKMEQQIIEEKVKLLLFCNPHNPGGRVWTK
EELLAIGRLCQKHQVTVVSDEIHQDLIFKPHTFTSFTVADDAFKEFTVTLTAATKTFNLA
GIKNSMLFIPNEKLRQSFVSLQDKNHQGGINTFGYVGTAAAYQTGEEWLTALLDYLKENI
DFALSFFREELPSVRVMEPEGTYLLWLDFSSYSLTDRELRDTLIHKGKVVLNPGISFGPQ
GSQHMRLNLACSKETLEEGLLRIKKAFN
Download sequence
Identical sequences A0A059N570 A0A0U1B288 A0A1Y0M2K7 E6GWE2 E6GZK0 Q830A1
NP_816514.1.90627 WP_002378885.1.100343 WP_002378885.1.100482 WP_002378885.1.101272 WP_002378885.1.101818 WP_002378885.1.10696 WP_002378885.1.11193 WP_002378885.1.12926 WP_002378885.1.13739 WP_002378885.1.14157 WP_002378885.1.14180 WP_002378885.1.16241 WP_002378885.1.16763 WP_002378885.1.17287 WP_002378885.1.17799 WP_002378885.1.18048 WP_002378885.1.18260 WP_002378885.1.20659 WP_002378885.1.23054 WP_002378885.1.23569 WP_002378885.1.24064 WP_002378885.1.25180 WP_002378885.1.274 WP_002378885.1.2799 WP_002378885.1.28932 WP_002378885.1.31656 WP_002378885.1.32099 WP_002378885.1.32385 WP_002378885.1.33306 WP_002378885.1.33460 WP_002378885.1.33574 WP_002378885.1.34192 WP_002378885.1.35810 WP_002378885.1.35823 WP_002378885.1.39119 WP_002378885.1.4014 WP_002378885.1.42483 WP_002378885.1.43540 WP_002378885.1.43903 WP_002378885.1.44185 WP_002378885.1.44242 WP_002378885.1.44626 WP_002378885.1.45925 WP_002378885.1.46056 WP_002378885.1.46348 WP_002378885.1.47407 WP_002378885.1.47856 WP_002378885.1.47867 WP_002378885.1.49131 WP_002378885.1.50067 WP_002378885.1.52926 WP_002378885.1.55065 WP_002378885.1.57048 WP_002378885.1.57136 WP_002378885.1.57542 WP_002378885.1.58620 WP_002378885.1.59564 WP_002378885.1.59698 WP_002378885.1.5994 WP_002378885.1.59964 WP_002378885.1.60361 WP_002378885.1.60394 WP_002378885.1.61083 WP_002378885.1.63148 WP_002378885.1.63507 WP_002378885.1.63848 WP_002378885.1.63884 WP_002378885.1.6473 WP_002378885.1.66316 WP_002378885.1.66898 WP_002378885.1.67683 WP_002378885.1.69648 WP_002378885.1.77328 WP_002378885.1.7819 WP_002378885.1.78503 WP_002378885.1.78641 WP_002378885.1.7958 WP_002378885.1.80104 WP_002378885.1.80452 WP_002378885.1.81327 WP_002378885.1.81575 WP_002378885.1.82993 WP_002378885.1.83490 WP_002378885.1.8380 WP_002378885.1.84260 WP_002378885.1.84632 WP_002378885.1.86134 WP_002378885.1.90371 WP_002378885.1.90503 WP_002378885.1.90872 WP_002378885.1.91394 WP_002378885.1.93277 WP_002378885.1.94630 WP_002378885.1.95534 WP_002378885.1.9570 WP_002378885.1.96481 WP_002378885.1.96745 WP_002378885.1.97078 WP_002378885.1.98868 WP_002378885.1.99 WP_002378885.1.9925 WP_002378885.1.99432 226185.EF2895 gi|29377360|ref|NP_816514.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]