SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29377439|ref|NP_816593.1| from Enterococcus faecalis V583

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29377439|ref|NP_816593.1|
Domain Number 1 Region: 5-364
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.59e-37
Family Cystathionine synthase-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|29377439|ref|NP_816593.1|
Sequence length 367
Comment pyridoxal phosphate-dependent enzyme [Enterococcus faecalis V583]
Sequence
MNSYEKFHLKEVINASGKMTILGVSKVSEAVLAAQRFGGEHFFEMSELSVQTGAFLANLL
KVEDAQIVSSASAGIAQSVAALIGKGSLYHAYHPYTEKIEQREIVLPKGHNVDYGTPVEV
MVAQGGGQVVEAGYANMCSPEHVEMMISEKTAAILYIKSHHTVQKSMLTVAEAAKVAQRH
KVPLIVDAAAEEDLFKYTEAGADLVIYSGAKAIEGPSAGLVVGKKEYIDWVRLQGKGIGR
AMKIGKDNILGFTQAVEEYLAHGSESGASMQERLKPFVEAINNLSDLTAKIVQDGAGRDI
YRASVKVDGRKTAKEVIQALKAESPAIYTREYQANNGIIEFDIRSVNQEEMNKIVQRLQE
IMDKKEK
Download sequence
Identical sequences A0A1Y0M479 Q82ZS2
APC86899 226185.EF2976 gi|29377439|ref|NP_816593.1| NP_816593.1.90627 WP_010706791.1.100343 WP_010706791.1.100482 WP_010706791.1.101818 WP_010706791.1.10696 WP_010706791.1.11193 WP_010706791.1.12926 WP_010706791.1.13739 WP_010706791.1.14157 WP_010706791.1.14180 WP_010706791.1.16241 WP_010706791.1.16763 WP_010706791.1.17287 WP_010706791.1.17799 WP_010706791.1.18048 WP_010706791.1.18260 WP_010706791.1.20659 WP_010706791.1.23054 WP_010706791.1.23569 WP_010706791.1.24064 WP_010706791.1.25180 WP_010706791.1.274 WP_010706791.1.2799 WP_010706791.1.28932 WP_010706791.1.31656 WP_010706791.1.32099 WP_010706791.1.32385 WP_010706791.1.33306 WP_010706791.1.33460 WP_010706791.1.33574 WP_010706791.1.34192 WP_010706791.1.35810 WP_010706791.1.35823 WP_010706791.1.36900 WP_010706791.1.39119 WP_010706791.1.4014 WP_010706791.1.42483 WP_010706791.1.43540 WP_010706791.1.43903 WP_010706791.1.44185 WP_010706791.1.44242 WP_010706791.1.46056 WP_010706791.1.46348 WP_010706791.1.47407 WP_010706791.1.47856 WP_010706791.1.49131 WP_010706791.1.52926 WP_010706791.1.57048 WP_010706791.1.57136 WP_010706791.1.57211 WP_010706791.1.57542 WP_010706791.1.58620 WP_010706791.1.59698 WP_010706791.1.59964 WP_010706791.1.60361 WP_010706791.1.60394 WP_010706791.1.61083 WP_010706791.1.63148 WP_010706791.1.63848 WP_010706791.1.63884 WP_010706791.1.6473 WP_010706791.1.66316 WP_010706791.1.66898 WP_010706791.1.77328 WP_010706791.1.7819 WP_010706791.1.78503 WP_010706791.1.78641 WP_010706791.1.7958 WP_010706791.1.80104 WP_010706791.1.80452 WP_010706791.1.81327 WP_010706791.1.81575 WP_010706791.1.82993 WP_010706791.1.83490 WP_010706791.1.8380 WP_010706791.1.84260 WP_010706791.1.84632 WP_010706791.1.90371 WP_010706791.1.90503 WP_010706791.1.90872 WP_010706791.1.91394 WP_010706791.1.93277 WP_010706791.1.95534 WP_010706791.1.9570 WP_010706791.1.96481 WP_010706791.1.96745 WP_010706791.1.97078 WP_010706791.1.98868 WP_010706791.1.99 WP_010706791.1.9925 WP_010706791.1.99432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]