SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|29377727|ref|NP_816881.1| from Enterococcus faecalis V583

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|29377727|ref|NP_816881.1|
Domain Number 1 Region: 28-387
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.55e-86
Family Cystathionine synthase-like 0.00000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|29377727|ref|NP_816881.1|
Sequence length 395
Comment cystathionine gamma-synthase [Enterococcus faecalis V583]
Sequence
MHVENDENICCEVEKGMEKMYHPMVPELVQTSSFYFPTYEEFMAASIDEKNNYVYTRGTN
PTTEILEKKIARLERGEKCKVFASGMGAISATLFTLLQQGDHVLMVNTIYGESVSFVQYL
EKFGVSLTKVDVAETEELFQFVQENTKVIYFESPSSQKFELLDLEKITALAQKIGAYTVI
DNTWASPLFQHPLCHNVDLVIHSCSKYIGGHSDIVAGAVIGKAALVDQIFEHGHQALGAV
NSPFNSWLALRGIRTMPVRLAHQSQAIQTVLLALQKDPRISRLYHPFVGNQQQQALAEKY
LTGYGSLFAIDLKDTDFERLKTFVNALTLVTIGVSWGGFESLALPVFKGNNLAAVQKRGL
SPAHIRMYVGLEEPTSIIEDIQQALDQAYGEESLL
Download sequence
Identical sequences A0A0U1B3I6 Q82YZ5
226185.EF3284 gi|29377727|ref|NP_816881.1| NP_816881.1.90627 WP_002379028.1.100343 WP_002379028.1.100482 WP_002379028.1.101272 WP_002379028.1.101818 WP_002379028.1.10696 WP_002379028.1.11193 WP_002379028.1.12926 WP_002379028.1.13739 WP_002379028.1.14157 WP_002379028.1.14180 WP_002379028.1.16241 WP_002379028.1.16763 WP_002379028.1.17287 WP_002379028.1.17799 WP_002379028.1.18048 WP_002379028.1.18260 WP_002379028.1.20659 WP_002379028.1.23054 WP_002379028.1.23569 WP_002379028.1.24064 WP_002379028.1.25180 WP_002379028.1.274 WP_002379028.1.2799 WP_002379028.1.28932 WP_002379028.1.31656 WP_002379028.1.32099 WP_002379028.1.32385 WP_002379028.1.33306 WP_002379028.1.33460 WP_002379028.1.33574 WP_002379028.1.34192 WP_002379028.1.35810 WP_002379028.1.35823 WP_002379028.1.36900 WP_002379028.1.39119 WP_002379028.1.4014 WP_002379028.1.42483 WP_002379028.1.43540 WP_002379028.1.43903 WP_002379028.1.44185 WP_002379028.1.44242 WP_002379028.1.44626 WP_002379028.1.45925 WP_002379028.1.46056 WP_002379028.1.46348 WP_002379028.1.47407 WP_002379028.1.47856 WP_002379028.1.47867 WP_002379028.1.49131 WP_002379028.1.50067 WP_002379028.1.50938 WP_002379028.1.52926 WP_002379028.1.55065 WP_002379028.1.56974 WP_002379028.1.57048 WP_002379028.1.57136 WP_002379028.1.57211 WP_002379028.1.57542 WP_002379028.1.58620 WP_002379028.1.59564 WP_002379028.1.59698 WP_002379028.1.5994 WP_002379028.1.59964 WP_002379028.1.60361 WP_002379028.1.60394 WP_002379028.1.61083 WP_002379028.1.62847 WP_002379028.1.63148 WP_002379028.1.63507 WP_002379028.1.63579 WP_002379028.1.63848 WP_002379028.1.63884 WP_002379028.1.6473 WP_002379028.1.66316 WP_002379028.1.66843 WP_002379028.1.66898 WP_002379028.1.67683 WP_002379028.1.69648 WP_002379028.1.77328 WP_002379028.1.7819 WP_002379028.1.78503 WP_002379028.1.78641 WP_002379028.1.7958 WP_002379028.1.80104 WP_002379028.1.80452 WP_002379028.1.81327 WP_002379028.1.81575 WP_002379028.1.82993 WP_002379028.1.83490 WP_002379028.1.8380 WP_002379028.1.84260 WP_002379028.1.84632 WP_002379028.1.86134 WP_002379028.1.90371 WP_002379028.1.90503 WP_002379028.1.90872 WP_002379028.1.91394 WP_002379028.1.93277 WP_002379028.1.94630 WP_002379028.1.95534 WP_002379028.1.9570 WP_002379028.1.96481 WP_002379028.1.96745 WP_002379028.1.98868 WP_002379028.1.99 WP_002379028.1.99014 WP_002379028.1.9925 WP_002379028.1.99432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]