SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88657803|ref|YP_507475.1| from Ehrlichia chaffeensis str. Arkansas

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88657803|ref|YP_507475.1|
Domain Number 1 Region: 530-1028
Classification Level Classification E-value
Superfamily ALDH-like 1.83e-125
Family ALDH-like 0.000000244
Further Details:      
 
Domain Number 2 Region: 179-522
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.53e-106
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000132
Further Details:      
 
Domain Number 3 Region: 8-177
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 3.01e-59
Family N-terminal domain of bifunctional PutA protein 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88657803|ref|YP_507475.1|
Sequence length 1044
Comment bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Ehrlichia chaffeensis str. Arkansas]
Sequence
MISALQTPNEIRRRMQMLYRIEENSCTRYLTEKTEISQDSKIRIYSVAKQIIERIRVDRN
LGIIDAFMQEYGLSNEEGIALMCLAESLLRIPDDCTINDLIKDKIGNSMWSNHIGSSSSM
FVNAATWGLFIGGKVLKDSNDSTRWFGTINNLLKTMGEPIIRKAVQQAMCILGKHFIKGR
DITEALNNRREGELYSFDILGEAAKTRKDAERYFTEYMAAVDSIGKSKVNNEIGNLIDYD
EISVKISALHSRYEFSQIDKVLDEIVDKLLQICKLAKEHNIRVCVDAEEASRLEISLMIL
EKLRFDSSLNGWEGLGLAVQAYQKRAFSVLDFVEDISVRSHHKMMVRLVKGAYWDYEIKN
AQELGLSSYPVFTRKVYTDVSYLACANKILSKPNTFSPCFATHNAYTLAAILEMANKDHP
GFEFQRLHGMGANLYEYVTQELAANVKCRVYAPVGSYQDLLPYLIRRLLENGANSSFINQ
LNDSNVSLEQLIEDPLEKARELEYLPHPSIPLPKDIFGPERLNSMGIDITDSVTLTNFNE
EMKNYQTCKFKAAPIIGGKELDGNFIEVFSPTNSEDIIGEVLFTDTAQALSALDMAYNAF
KDWSNIPVSTRAAILEKAANLIEENKAKLIMLLIREGGKVISDAIAEIREAVDFLRYYAV
LGRQELEQSRKLPGPVGEDNYLYFRSRGVFVCISPWNFPLAIFVGPIAAALVTGNTVLAK
PAEQTSIIAYETVKLLHDAGVPKEVLHLLLGSGKELGEALLRNEKIGGVAFTGSTETARI
INQSIAEKEGGIIPFIAETGGLNTMITDTSALIEQVTNDVITSAFKSAGQRCSALRVLFV
QEEVADKQIEMICGAMEDLVVGDPMLLKTDIGPVIDKASQEMLIAHEDRMSREAKLLYKV
KLGEDCEKGYFFAPCVYEIQSISQLKREVFGPILHIIRYKKGDLHRILDEINSTGYGLTF
AVQSRVQSNIDVIIDSVNVGNVYVNRNQVGAVVGVQPFGGQGLSGTGPKAGGPYYLHRFL
TEKVVSINTTALGGNTTLMCLTDQ
Download sequence
Identical sequences Q2GGF8
205920.ECH_0667 gi|88657803|ref|YP_507475.1| WP_011452748.1.20904 WP_011452748.1.31359 WP_011452748.1.42435 WP_011452748.1.42678 WP_011452748.1.56909 WP_011452748.1.68154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]