SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|188532556|ref|YP_001906353.1| from Erwinia tasmaniensis Et1/99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188532556|ref|YP_001906353.1|
Domain Number 1 Region: 30-147
Classification Level Classification E-value
Superfamily PapD-like 4.45e-38
Family Pilus chaperone 0.0000121
Further Details:      
 
Domain Number 2 Region: 156-247
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 6.67e-24
Family Periplasmic chaperone C-domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188532556|ref|YP_001906353.1|
Sequence length 253
Comment periplasmatic chaperonin (mannose-resistance fimbriae), MrfD protein [Erwinia tasmaniensis Et1/99]
Sequence
MNRSVMKYLAAVTLTTAGLLAGVQQASAAIALDRTRVIFNGGSHSMSVNISNQNRELPYL
AQGWIEDDKGNKIESPLLILPPLQRVEPGAKSQVKIQGTPALNALPQDRESLFYFNLREI
PPRSEKPNTLQIALQTRIKLFYRPARLQAGQNEYNDPWQKKITLTREGDKYRLNNPTPYF
VTLVAAETSQSGKDIASFNPLMVAPKNSSLLTLSAETLGSTPVLTYINDFGGRPKLVFSC
NGATCSVKENLPG
Download sequence
Identical sequences B2VL17
465817.ETA_04020 gi|188532556|ref|YP_001906353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]