SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188535146|ref|YP_001908943.1| from Erwinia tasmaniensis Et1/99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188535146|ref|YP_001908943.1|
Domain Number 1 Region: 55-504
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.99e-119
Family Pyridoxal-dependent decarboxylase 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|188535146|ref|YP_001908943.1|
Sequence length 517
Comment decarboxylase [Erwinia tasmaniensis Et1/99]
Sequence
MVLGSHTSQVTERHPGYRAGDPHDFIFNDHQLPAWVQQSEQVLALITETVKGVEKPFSGI
LPHELAREFSGVNLDQPLGSNEAALEELKKLYLRDAVWFHHPKYVAHLNCPVVLPSLLAE
QIMATVNSSVDTWDQSAGGTLIEQKVIDWTLGRIGLPAGADGIFTSGGTQSNLMAMLLAR
DSWCAAHHQGHMIKHQGLPQDAAKWRVFTSKLSHFSIQKSMAILGLGYDAVIPVDFDEHY
RMDAACLEQEIQRCHQQGLIPIAVVATSGTTDFGSIDPLGAISDLCNQHGMWMHVDAAYG
CGLLVSENHRQRLAGIEKADSVTVDYHKSFFQTVSCGAFFVRDKHNLSHVTHHADYLNPL
SAQQEGTPNLVNKSIQTTRRFDALKMWLTLRISGPTALGNAFDDILALTQTTHQLLNAHP
TIEVLHAPELTTQIFRYVPRPGLNDEQIDDINANIRKAVFRSGNAVIAGTKVNGRQYLKF
TLLNPNTTVADIEDVIALIVHYGREQACGPTVTTAHL
Download sequence
Identical sequences B2VCR4
465817.ETA_30280 WP_012442725.1.58220 gi|188535146|ref|YP_001908943.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]