SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002198 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002198
Domain Number 1 Region: 1-184
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 4.24e-58
Family Ran-binding protein mog1p 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002198   Gene: ENSEEUG00000002415   Transcript: ENSEEUT00000002407
Sequence length 186
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7513:82441:83697:1 gene:ENSEEUG00000002415 transcript:ENSEEUT00000002407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTRDHPLFGGAFSATLPPGAIDVSDLRPIPDNQEVFCHRVTDQSLIVELLELQAHVQG
EAAARYHFEDVGGVQGARAVQVDTVQPLLLENLALRDCCQEAWVLSGKQQVAKENQQATK
NVTLHQALLRLPQYQTDLLLTFNQPPPDNRSSLGPENLSPLPWSLGDFEQLVASLTLHDP
NIFGPQ
Download sequence
Identical sequences A0A1S2ZPG0
XP_007522534.1.11023 ENSEEUP00000002198 ENSEEUP00000002198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]