SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003669 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003669
Domain Number 1 Region: 19-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000458
Family KRAB domain (Kruppel-associated box) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003669   Gene: ENSEEUG00000004056   Transcript: ENSEEUT00000004033
Sequence length 87
Comment pep:novel scaffold:HEDGEHOG:scaffold_349638:1512:3674:-1 gene:ENSEEUG00000004056 transcript:ENSEEUT00000004033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSTFKTGTQENNQKSNMHKAFMAISKYFSKKEWAKLGYTEKTTYVYMKRNYETMSALGL
RATLPTFMCSGKPTTEFNGNNSVHDEN
Download sequence
Identical sequences ENSEEUP00000003669 ENSEEUP00000003669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]