SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004156 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004156
Domain Number 1 Region: 1-92
Classification Level Classification E-value
Superfamily Ribosomal protein L20 7.59e-18
Family Ribosomal protein L20 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004156   Gene: ENSEEUG00000004596   Transcript: ENSEEUT00000004565
Sequence length 120
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3561:3378:6877:-1 gene:ENSEEUG00000004596 transcript:ENSEEUT00000004565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HFRGRKNCCYRLAVRAVTRAFVNCTKARKLKKRNLRTXXXXXXXXXXXXXXXXXXXXXXX
XXXCQVELNRKVLSDLAIYEPKTFKSLAALSKRRHEEGLAAALGDEKEPEGIFSRIVHYH
Download sequence
Identical sequences ENSEEUP00000004156 ENSEEUP00000004156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]