SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010574 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010574
Domain Number 1 Region: 92-212
Classification Level Classification E-value
Superfamily dUTPase-like 5.89e-32
Family dUTPase-like 0.00000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010574   Gene: ENSEEUG00000011602   Transcript: ENSEEUT00000011590
Sequence length 213
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3407:23:14314:1 gene:ENSEEUG00000011602 transcript:ENSEEUT00000011590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVRCCPRLPPPLRSPFGDAVCAGLRSVAASPARQGPAIGPFPRGAGLLLATRPHCSARRP
GAGNAAPGCKDADNLATSPSKRARAAEEGPSRLRFVRLSEHATAPTKGSARAAGFDLYSA
YDYTVPPMEKALVKTDIQIALPSGCYGRVXXXXXXXXXXXXXXXXGVIDEDYRGNVGVVL
FNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQ
Download sequence
Identical sequences ENSEEUP00000010574 ENSEEUP00000010574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]