SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014460 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014460
Domain Number 1 Region: 26-199
Classification Level Classification E-value
Superfamily CutC-like 1.7e-64
Family CutC-like 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014460   Gene: ENSEEUG00000015836   Transcript: ENSEEUT00000015838
Sequence length 199
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8451:132797:163188:1 gene:ENSEEUG00000015836 transcript:ENSEEUT00000015838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRQAASSERKRARVPSGTAGAAGFLMEVCVDSVESAVNAERGGAGRIELCSSLLEGGTT
PSMGVLQVVKQCVQIPVFVMIRPRGGDFLYSDREVEVMKADIHLAKLYGADGLVFGALTE
DGHIDKELCMSLVAICRPLPVTFHRAFDMVHDPMEALETLITLGFERVLTSGCDSSALEG
LPLIKRLMEQAKGRIVVMP
Download sequence
Identical sequences ENSEEUP00000014460 ENSEEUP00000014460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]