SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002336 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002336
Domain Number 1 Region: 102-186
Classification Level Classification E-value
Superfamily E set domains 0.0000000207
Family Filamin repeat (rod domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002336   Gene: ENSEEUG00000002564   Transcript: ENSEEUT00000002556
Sequence length 557
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4763:5337:68165:1 gene:ENSEEUG00000002564 transcript:ENSEEUT00000002556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWINFFKLRLFCCVLAVLMVVVLIINVTQVEYLDRETVSATFIDSSGQFVSSQMIGISRN
PYCGYEHQILSPHERMEEDSLLAALQWQVPDVGPVPFMKSTDPSSSYFVILNSAAAFEVG
SQLEVLVHVQDFQRKPKKYGGDYLQARIHSRHLQAGAVGRVIDYQNGFYKVFFTLLWPGK
VKVSISLVHPSEGIRVLQHLQEDKPDRVYFKSLFRSGRISETTECNVCLPGNRPLCNFTD
LYTGEPWFCFKPKKLPCSSRINHFKGGYLKGLLTAAENAFFQSGINIKMPINASGPDWVT
VIPKRIKEANNIELSQGSGTFPSGYYYRDQWRPRKFQMRQFNDPNNVTECLERKVVYLFG
DSTIRQWFEYLTTFVPXXXXXXXXXXXXXXXXXXXDQKHNILKYRCHGPPIFKTVFSSEL
HYVANELNGIVGGKNTVVAIAVWSHFSTFPLEVYIRRLRNIRRAVVHLLDRSPKTVVVIR
TANVQELGPEVSLFNSDWYNFQLDTVLRKMFSGVGVYLVDAWEMTLAHYLPHKLHPDEVI
VKNQLDMFLSFVCPLEI
Download sequence
Identical sequences ENSEEUP00000002336 ENSEEUP00000002336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]