SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for psu|LmjF27.1820 from Leishmania major strain Friedlin

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|LmjF27.1820
Domain Number 1 Region: 765-1021
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000196
Family Tropomyosin 0.0016
Further Details:      
 
Domain Number 2 Region: 1023-1277
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000085
Family Tropomyosin 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|LmjF27.1820
Sequence length 2257
Comment | organism=Leishmania_major | product=hypothetical protein, unknown function | location=Lmjchr27:780438-787211(-) | length=2257
Sequence
MPSSHTSLPFPSYGEQPARPPPAGVLSADLARPISVRELAQSRVPAVPPPPPATQTPRSR
ATTAGFAGFGVPTSSAVYAATSGVSTSQPLPAHADAGDLTSLAHRDIDHLSGRELYNYAS
HLRESSQQYGGYLSEAYAKRDQYRGEVARLKEELHNRYMEIDVLRREQERARDALLKVRE
DNAQLRQKLAEAEGHARNMQAKISVLSGADPSLAVHFYQSQLALKDAQLRELQQECERAA
AASSQRRSSSTTAAEHGRRSANISGEGAAAPHTSPSCDLPSAEELKGGTEAASAALHTAL
EELQCLNTSLSHRLEDEHTAHKAALAAHAEASATATADRAELLDTIAQLRQQCADMQNVE
DELVAALTLRAPISKKDYAALQASYDDLTAALAKAEAQVAALQENEQQHHHSAQQAQEEL
RRSLTTGLEERQSMQVRNEQMQSLVNHLEKELKLAERANQLRQEQLDAAISGNQQLAESL
HVAQEQLLSATSELQDLRDTRESLESQHRELRQRIEELEQGDEHQRHQHGEAEAESEASQ
QRQELEAELARLRSQRDVLVGDRDDIVGDVRRLPDERRALLTSPPAHAEEQLQSRSSAVR
APLDVHADDGERQNQEDIAALEAAHRCIEQMKQTIAALQSERVRVEADLKAKVNTLEAEL
ASQSRALAEAEAAAAAQQAHLEEVVMALRDELVATQAQEKMLRASEKAHQERCVEQQRAV
EQMQAHVEELKTAARNAASSLSTPPPARPATAAESEQIAMNAALSSLAYQLEDAQHRVEE
LSAEHARTVEELARATRAVAELEARAAGAEGKREVMHTAAEVAEAELMARVAALTTENAQ
LKEKLSISRAAVTTFASRQTDGEGAAASLEERCAAEARRSEAAEAEASALRGTLDRTAAE
LAEVLQRSEDVQATLERTVARLAEQESLVGALSAESTRLQDELATAQRSVLLLTGERDAL
GEEAAGLRGELSAAEDRASDVAAAQQRLQVRLEEAEAAVRSKDVELSTALAALDRTASEM
CDAEQRLQVYSEAKEQLAAEHARTVEELARATRAVAELEARAAGAEGKREVMHTAAEVAE
AELMARVAALTTENAQLKEKLSISRAAVTTFASRQTDGEGAAASLEERCAAEARRSEAAE
AEASALRGTLDRTAAELAEVLQRSEDVQATLERTVARLAEQESLVGALSAESTRLQDELA
TAQRSVLLLTGERDALGEEAAGLRGELSAAEDRASDVAAAQQRLQVRLEEAEAAVRSKDV
ELSTALAALDRTASEMCDAEQRLQVYSEAKEQLAAEHARTVEELARATRAVAELEARAAG
AEGKREVMHTAAEVAEAELMARVAALTTENAQLKEKLSISRAAVTTFASRQTDGEGAAAS
LEERCAAEARRSEAAEAEASALRGTLDRTAAELAEVLQRSEDVQATLERTVARLAEEEEL
VEQLNYDASELSDARAALTEEVTRLQKALAAAVTDKADVLAQLLATQKELDRAAEVQDAQ
YRDEELLQNALATTTSAFDVQTKQVRLGMAHVVDMSRAFCRVAEVAVQRSAAGVDGAAST
GANVQEILSPWARALEWVAAMEQRLETLDMGAMSNSLSRTDGRRERRRRRRGRTTELEGD
NAVEMEANSGSHALSSSSLCRVVSINCAEAAFARLMDEQAAATNTIADLRRTLVDKEVDL
TNLRSAMDALASDLISERDRADNLSAAIDDASEKIASAQAEFEEQLRQRTAATTAEVVEA
RRAEARATAAQLRAEEQLAVVEKDLKEQEGVLRKLQDENHRLTREADRLLRTSRLEPSSR
VRSNVSGSVTPKSLSLSAASAEDAVQRFTTAPSTLEAVEQAQILQVSSLQADLLLSRRQA
RELEGREATLRQACAALEQQVSELRVEAAEAEHLREDMATLRADYAELEQRYSELERMAI
AAGGGTMQELKQLRQQLKVREVELEELKARMRDLVLSKAAPELEAARRQEALRESLSGIT
TQLAATQAQYGGGTGGSSTVRSRRASLTAAVSNSDLLSLSSSRPSPQDVLTSRIEHLQTL
VNDRDVALEKVQAAQLESRAAMDTLEDQLAAKTAALERAEGLVAEYADSVNNAFTMAAVV
GRGNRGAGPTTVPPLSSEMGSPDAAALSASVPPLTPLTPRTRAAVNGQPHAAVAMASPAP
RMPNLDEVADDSDGSGEGKQAGSAGPSTDSAPPPVTHRRTRASGSWRDGKSCPAHRPSSS
TERSAPSSPSNVPGRKSFASASVPATTRKRARSRTNT
Download sequence
Identical sequences E9ADG0
XP_003721989.1.98313 psu|LmjF27.1820 gi|70800089|gb|AAZ09930.1| gi|73544487|ref|XP_848138.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]