SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_005070 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_005070
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.01e-30
Family N-acetyl transferase, NAT 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_005070
Sequence length 177
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=acetyltransferase, GNAT family | location=DS571195:59648-60302(-) | length=177
Sequence
MINIRRATPEDLPKLQGANLINLAENYTMKYYYYHLLLWPSITYLAECVDGKVVGYVLTK
MDEDSTTPFGHITSISVLRSYRRLGIATKLLRAAENSMIECFGAEYVTLHVRESNKPARH
LYEVTMGYKQHSVDKKYYNDGEDAIVMRHYLNVSNLSNPDASSDLLDVWKSKHLVSA
Download sequence
Identical sequences A0A175JLS0 C4M0A1 M2QCL1 M3UGX5 N9UPA9
294381.C4M0A1 jCVI|EHI_005070 gi|56469731|gb|EAL47452.1| gi|67474182|ref|XP_652840.1| XP_652840.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]