SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jCVI|EHI_061000 from Entamoeba histolytica 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jCVI|EHI_061000
Domain Number 1 Region: 42-180
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.66e-19
Family N-acetyl transferase, NAT 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jCVI|EHI_061000
Sequence length 181
Comment | organism=Entamoeba_histolytica_HM-1:IMSS | product=acetyltransferase, putative | location=DS571413:12328-12929(+) | length=181
Sequence
MRRTNQKATRGNLLLKMANELQLNNEKLTTHPIEIIPCKSIKKEQLQMCFELVKENMFSL
DSVSSLGWNDHDKMEEMKQGNGFYILFKEGFVCIRFELFGNGIQCYLWEIQIKKEYRRQG
IGKEMMNVIEIISKKAHCSEISLLVLKSNVEGKAFYDKLHFEVKKQDSKDQDYWIMRKKL
N
Download sequence
Identical sequences A0A175JXK5 B1N4H5 M2S4W6 N9TQQ4
jCVI|EHI_061000 XP_001914091.1.49425 294381.B1N4H5 gi|169800884|gb|EDS89133.1| gi|183234835|ref|XP_001914091.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]